KEGG   Rhodopseudomonas palustris HaA2: RPB_2123Help
Entry
RPB_2123          CDS       T00321                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rpb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpb00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpb00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2414132..2415850
Genome map
AA seq 572 aa AA seqDB search
MTTFQQARSFLLDHRTDYSAAVAGFRWPDPVPFNWALDWFDAELATSGSRNRPALWIVDG
TTGREEKPSFAHLSKRSNQVANYLRAKGLKRGDHLLLLLGNVVPLWEVMLAAIKLGLVTI
PATTLLTPDELRDRLERGRAKAVVAAPDQIAKFKGLGGDDLLRVVVGDAQDGWLNYDGTA
LQPDVFTPDGPTQADDPMLLYFTSGTTAKPKLVRHSQRSYPVGALSTMFWLGLQPGDVHL
NISSPGWAKHAWSCLFAPWNAGATVFVVNQPRFDAKSLLATIGRCGVTTLCAPPTVWRMF
IQEKLADYQVSLREVCGAGEPLNPEVIDQVKAAWGLTIRDGYGQTETTAMVGNSPGQAVK
IGSMGRPMPGYVVKITDADGHPAKEGEITLALGDARPAGLMQGYQSEGGKLSGADGDIYR
SGDVAFADDDGYLTFVGRTDDVFKSSDYRISPFELESVLLEHDAVAEAAVVPSPDPIKLA
IPKAYVLLTADAERSRDTALSIFRHMQARMAPFKRIRKLELVTELPKTISGKIRRVHLRR
IEHEHDQTDSLRGVEFREEDFPELKAAPTQEG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattccaacaggcccgttccttcctgctcgaccatcgcaccgactactccgcc
gccgtcgcgggtttccgctggcccgatccggtgccgttcaactgggcgctcgactggttc
gatgccgagttggcgacgtccggcagccgtaaccgtcccgcgctgtggatcgtcgacggc
accaccggccgggaggagaagccgagcttcgcgcatctgtcgaagcgctcgaaccaggtc
gcgaactatctgcgtgccaagggcctgaagcgcggcgatcacctgctgctgctgctcggc
aacgtcgtgccgttgtgggaggtgatgctggcggcgatcaagctcggcctcgtcaccatc
ccggcgaccacgctgctgacgccggacgagttgcgcgaccggctcgagcgcggccgcgcc
aaggcggtggtcgctgcgcccgaccagatcgccaaattcaagggcctcggcggcgacgat
ctgctgcgcgtcgtggtcggcgacgcccaggacggctggctcaattacgacggaaccgcg
ctgcagcccgacgtcttcacgccggacgggccgacgcaggctgacgatccgatgctgctg
tatttcacctccggcaccacggcgaagccgaagctggtgcggcacagccagcgcagctat
ccggtcggcgcgctgtcgacgatgttctggctcgggctgcagcccggcgacgtgcatctc
aacatctcgtcgccgggctgggccaagcacgcctggagctgcttgttcgcgccgtggaac
gccggcgccaccgtgttcgtcgtcaaccagccgcggttcgacgccaagagtctcttggcg
acgatcggccgctgcggcgtcaccacgctgtgcgcgccgccgacggtgtggcggatgttc
attcaggagaagctcgcggactatcaagtgtcgctgcgcgaggtctgcggcgccggcgag
ccgctcaatccggaagtgatcgatcaggtcaaggccgcctggggcctcaccatccgcgat
ggctacggccagaccgagaccaccgcgatggttggcaattcgccggggcaggcagtgaag
atcggctcgatgggccggccgatgccgggctacgtcgtcaagatcaccgatgcggacggt
catccggccaaggaaggcgagatcacgctggcgctgggcgacgcgcgcccggccggcctg
atgcagggttatcaaagcgagggcggcaagctctcgggcgccgacggcgacatctatcgc
tccggcgacgtcgccttcgccgacgacgacggctatctcaccttcgtcggccgcaccgac
gacgtgttcaaatcgtcggactatcggatctcgccgttcgaactggagagcgtgctgctc
gaacacgatgccgtcgccgaagccgcggtggtgccgagcccggacccgatcaagctggcg
atcccgaaggcctatgtgctgctgacggcggacgcggagcgctcgcgcgacaccgcgctg
tcgatcttccgccacatgcaggcgcggatggcgccgttcaagcgcatccgcaagctcgaa
ctggtcaccgaactgccgaagacgatctcgggcaaaatccgccgcgtgcatctgcgccgc
atcgagcacgagcacgaccagaccgactcgttgcgcggcgtcgagtttcgcgaagaggat
ttccccgagttgaaagccgcgccgacgcaggaggggtga

DBGET integrated database retrieval system