KEGG   Rhodopseudomonas palustris HaA2: RPB_2123Help
Entry
RPB_2123          CDS       T00321                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00010  Glycolysis / Gluconeogenesis
rpb00620  Pyruvate metabolism
rpb00640  Propanoate metabolism
rpb00680  Methane metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPB_2123
   00620 Pyruvate metabolism
    RPB_2123
   00640 Propanoate metabolism
    RPB_2123
  Energy metabolism
   00680 Methane metabolism
    RPB_2123
Enzymes [BR:rpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPB_2123
Lipid biosynthesis proteins [BR:rpb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPB_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABD06829
JGI: RPB2123
UniProt: Q2IY81
Position
2414132..2415850
Genome map
AA seq 572 aa AA seqDB search
MTTFQQARSFLLDHRTDYSAAVAGFRWPDPVPFNWALDWFDAELATSGSRNRPALWIVDG
TTGREEKPSFAHLSKRSNQVANYLRAKGLKRGDHLLLLLGNVVPLWEVMLAAIKLGLVTI
PATTLLTPDELRDRLERGRAKAVVAAPDQIAKFKGLGGDDLLRVVVGDAQDGWLNYDGTA
LQPDVFTPDGPTQADDPMLLYFTSGTTAKPKLVRHSQRSYPVGALSTMFWLGLQPGDVHL
NISSPGWAKHAWSCLFAPWNAGATVFVVNQPRFDAKSLLATIGRCGVTTLCAPPTVWRMF
IQEKLADYQVSLREVCGAGEPLNPEVIDQVKAAWGLTIRDGYGQTETTAMVGNSPGQAVK
IGSMGRPMPGYVVKITDADGHPAKEGEITLALGDARPAGLMQGYQSEGGKLSGADGDIYR
SGDVAFADDDGYLTFVGRTDDVFKSSDYRISPFELESVLLEHDAVAEAAVVPSPDPIKLA
IPKAYVLLTADAERSRDTALSIFRHMQARMAPFKRIRKLELVTELPKTISGKIRRVHLRR
IEHEHDQTDSLRGVEFREEDFPELKAAPTQEG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattccaacaggcccgttccttcctgctcgaccatcgcaccgactactccgcc
gccgtcgcgggtttccgctggcccgatccggtgccgttcaactgggcgctcgactggttc
gatgccgagttggcgacgtccggcagccgtaaccgtcccgcgctgtggatcgtcgacggc
accaccggccgggaggagaagccgagcttcgcgcatctgtcgaagcgctcgaaccaggtc
gcgaactatctgcgtgccaagggcctgaagcgcggcgatcacctgctgctgctgctcggc
aacgtcgtgccgttgtgggaggtgatgctggcggcgatcaagctcggcctcgtcaccatc
ccggcgaccacgctgctgacgccggacgagttgcgcgaccggctcgagcgcggccgcgcc
aaggcggtggtcgctgcgcccgaccagatcgccaaattcaagggcctcggcggcgacgat
ctgctgcgcgtcgtggtcggcgacgcccaggacggctggctcaattacgacggaaccgcg
ctgcagcccgacgtcttcacgccggacgggccgacgcaggctgacgatccgatgctgctg
tatttcacctccggcaccacggcgaagccgaagctggtgcggcacagccagcgcagctat
ccggtcggcgcgctgtcgacgatgttctggctcgggctgcagcccggcgacgtgcatctc
aacatctcgtcgccgggctgggccaagcacgcctggagctgcttgttcgcgccgtggaac
gccggcgccaccgtgttcgtcgtcaaccagccgcggttcgacgccaagagtctcttggcg
acgatcggccgctgcggcgtcaccacgctgtgcgcgccgccgacggtgtggcggatgttc
attcaggagaagctcgcggactatcaagtgtcgctgcgcgaggtctgcggcgccggcgag
ccgctcaatccggaagtgatcgatcaggtcaaggccgcctggggcctcaccatccgcgat
ggctacggccagaccgagaccaccgcgatggttggcaattcgccggggcaggcagtgaag
atcggctcgatgggccggccgatgccgggctacgtcgtcaagatcaccgatgcggacggt
catccggccaaggaaggcgagatcacgctggcgctgggcgacgcgcgcccggccggcctg
atgcagggttatcaaagcgagggcggcaagctctcgggcgccgacggcgacatctatcgc
tccggcgacgtcgccttcgccgacgacgacggctatctcaccttcgtcggccgcaccgac
gacgtgttcaaatcgtcggactatcggatctcgccgttcgaactggagagcgtgctgctc
gaacacgatgccgtcgccgaagccgcggtggtgccgagcccggacccgatcaagctggcg
atcccgaaggcctatgtgctgctgacggcggacgcggagcgctcgcgcgacaccgcgctg
tcgatcttccgccacatgcaggcgcggatggcgccgttcaagcgcatccgcaagctcgaa
ctggtcaccgaactgccgaagacgatctcgggcaaaatccgccgcgtgcatctgcgccgc
atcgagcacgagcacgaccagaccgactcgttgcgcggcgtcgagtttcgcgaagaggat
ttccccgagttgaaagccgcgccgacgcaggaggggtga

DBGET integrated database retrieval system