KEGG   Rhodopseudomonas palustris HaA2: RPB_2167Help
Entry
RPB_2167          CDS       T00321                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPB_2167
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RPB_2167
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RPB_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2458560..2459810)
Genome map
AA seq 416 aa AA seqDB search
MQVQIDIPGEDAQGRVFLGWTPVQASARLLQGPGAGSVDVEISSAGAVGGLVFDTARTHN
GGSRLTLGLPGDGRPVTFFVAGEFLKPSSRYGDAAIAVKDKASGAPLASKPVMVRIRKNA
VTLSQEERDDFLAALGTLNARGQGPYRIVRDMHDADSDLEIHRNEGFLPWHRAYVLGLER
ALQAINPVVTLPYWQFDAPAPVLFTIDYMGRSDESGHVVFRPGHSLEHWVAKDTPGIVRV
PRFASDAPALVISEDDTIRLGGATADFALFRQMEGGPHGQAHNSFAAPSPLRYPALAVYD
PLFFLLHCNVDRLWTKWQWIKHRTDSSDRLAYSDGTRAGTKRGDTMWPWNGIHGNPRPPT
APGGPFPPTSTTPAPGRTPRVSDMLDAMALKAPDPLGFAYDDVPFQLPPTVVAGHA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccaaatcgatattcccggtgaagatgcccaaggtcgcgtgtttctcggctgg
acgcccgttcaggccagcgcccggttgttgcagggtccaggtgccggctccgtcgacgtc
gagatcagcagcgccggcgcggtcggcgggctggtgttcgatacggcgcgaacgcacaac
ggcggctcgcgcctgacgctcggcctgccgggtgacggccggccggtgacgttcttcgtc
gcgggcgaattcctcaagccgagttcgcgttacggcgacgccgccatcgccgtgaaggac
aaggccagcggcgccccgctcgccagcaagccggtgatggtgcgcatccgcaaaaatgcg
gtcacgttgagccaggaggagcgcgacgacttcctcgccgcgctcggcaccctgaatgcg
cgcggccagggtccctatcgtatcgttcgcgatatgcacgacgccgattcggatctcgaa
atccatcgcaacgaaggcttcctgccgtggcaccgcgcctacgtgctcgggctcgagcgc
gcgctccaggcgatcaacccggtggtgacgctgccctattggcagttcgacgcgcccgcg
cctgtgctcttcaccatcgactacatgggacgatccgacgaatccggccacgtcgttttc
cggcccgggcactcgctcgagcactgggtggcgaaggatacgcccgggatcgtccgcgtg
ccgcgatttgcgtccgacgctccggcgctggtcatcagcgaagacgatacgatcaggctc
ggcggggcgacagccgatttcgccctgtttcggcaaatggagggcgggccgcacggtcag
gcgcacaacagctttgccgcccccagcccgctcaggtaccccgccctcgccgtctatgat
cctttgttcttcctgctccactgcaatgtcgaccggctgtggacgaaatggcagtggatc
aagcaccgcacggacagctccgaccggctcgcctacagcgacggcacgcgcgccggcacc
aagcgcggcgacacgatgtggccgtggaatggcatccacggcaatccgcggccgccgact
gcaccgggcggaccgtttcctccgaccagtaccacgccggcgccgggccgcacgccaagg
gtcagcgacatgctcgatgcgatggcgctcaaggcgcccgatccgctcggcttcgcctac
gacgacgtgccgttccagctgccgccgaccgtggttgcaggtcatgcctag

DBGET integrated database retrieval system