KEGG   Rhodopseudomonas palustris HaA2: RPB_2350Help
Entry
RPB_2350          CDS       T00321                                 

Definition
(GenBank) Thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPB_2350
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_2350
   00640 Propanoate metabolism
    RPB_2350
   00650 Butanoate metabolism
    RPB_2350
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_2350
   00072 Synthesis and degradation of ketone bodies
    RPB_2350
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPB_2350
   00310 Lysine degradation
    RPB_2350
   00380 Tryptophan metabolism
    RPB_2350
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPB_2350
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPB_2350
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPB_2350
Enzymes [BR:rpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPB_2350
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPB_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2700822..2701970
Genome map
AA seq 382 aa AA seqDB search
MTIRGKAFIAGIYEHPTRHAPDKSIAQLHAEVAKGALEDAGLTKDDIDGYFCAGDAPGGG
MAMVDYLGLKVRHLDTTDTGGSSYLILLAHAAEAIAAGRCSVALITLAGKPRTGALPPRP
VGAEGDFELAYGATTHNVYAMCAARHMHDYGTTSEQLAWIKVAASHHAQYNEHAMLRDVV
TVEDVLNSPLIADPLHRLDCCVVTDGGGALIVTSEAIARSLKRPLVRLIGAGEAVKGPRG
GQKLDLTYSAGVWSAPPAFEMAGITPKDIKYASIYDSFTITVLMQLEDLGFCKKGEGGKF
VADGNLISGVGKLPFNTDGGGLCSNHPVNRGGMTKILEAVRQLRGEAHPKVQVPNCDLAI
AHGTGGMLGIRHAASTCILERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgacaataagaggcaaggctttcattgccggaatttacgaacaccccacgcgccacgcg
cctgacaaatccatcgcccagctccacgccgaagtcgccaaaggcgcgctcgaagacgcc
ggcctgaccaaggacgacatcgacggctatttctgcgccggcgatgcaccgggcggcggg
atggcgatggtggattatctcgggctgaaagtccgccacctcgacaccaccgacaccggc
ggctcctcctatctgatccttctcgcccacgccgcggaggcgatcgcggccggccgctgc
tcggtggcgttgatcacgctggccggcaagccgcggaccggcgcgctgccgccgcgtccg
gtcggcgccgagggtgatttcgagctggcctatggcgcgacgacgcacaatgtctatgcg
atgtgcgcggcgcgccacatgcacgactacggcaccacgtcggagcagctcgcctggatc
aaggtcgcggcctcgcatcacgcgcaatacaacgagcacgcgatgctgcgcgacgtcgtc
actgtcgaagacgtgctgaactcgccgctgatcgccgacccgctgcatcggctcgactgc
tgcgtcgtcaccgacggcggcggcgcgctgatcgtcacgtccgaggcgatcgcgcgcagc
ctgaagcggccgctggtgcggttgatcggcgccggcgaggcggtcaaggggccgcgcggc
gggcagaagctcgacctgacctattcggcgggcgtgtggtcggcgccgccggccttcgag
atggccggcatcaccccgaaggatatcaaatacgcctcgatctacgacagcttcaccatc
accgtgctgatgcagctcgaagacctcggcttctgcaagaaaggcgagggcggcaagttc
gtcgccgacggcaatctgatttccggcgtcggcaagctgccgttcaacaccgatggcggc
ggactgtgcagcaatcatccggtgaatcgcggcggcatgaccaagattctggaagccgtg
cgccagctccgcggcgaagcgcatcccaaggtgcaggtgccgaactgcgacctcgccatc
gcccacggcaccggcggcatgctcggcatccgccacgccgcatctacctgcattctggag
cgcgtgtga

DBGET integrated database retrieval system