KEGG   Rhodopseudomonas palustris HaA2: RPB_2472Help
Entry
RPB_2472          CDS       T00321                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00230  Purine metabolism
rpb01100  Metabolic pathways
Module
rpb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPB_2472
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RPB_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 TsaE cobW MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABD07177
JGI: RPB2472
UniProt: Q2IX83
Position
2828504..2829166
Genome map
AA seq 220 aa AA seqDB search
MKDGAAGSLNGIERRGLMFVLSSPSGAGKTTLSRMLVDEAPGLRMSVSATTRPKRPGEVD
GRDYYFVDRPKFDAMVEAGEFLEWANVFDNCYGTPRAPVEAALSAGNDVLFDIDWQGTQQ
LRSRASNDVVSVFILPPSVQDLEHRLHTRAQDSDEVIRGRMKKAGDEMSHFDAYDYIVVN
DNIGVAFESVKAILRAEQLKRERQIGIDAFVREMRRELEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacggggcggcaggcagcctgaacggcatcgagcggcgcggattgatgttcgtg
ctgtcgtcgccgtcgggcgccggcaagacgacgctctcgcgtatgctggtcgacgaggcg
ccgggattgcggatgtcggtgtcggcgacgacccggccgaagcggccgggcgaagtcgac
ggccgtgactactacttcgtcgatcggccgaaattcgacgccatggtcgaggccggcgag
tttctcgaatgggccaacgttttcgacaattgttacggcacgccgcgcgcgccggtcgaa
gcggcgctctcggccggcaacgacgtgctgttcgacatcgactggcagggcacccaacag
ttgcgcagccgggcgtcgaacgacgtcgtcagcgtcttcatccttccgccgtcagttcag
gacctcgagcatcggctccacacgcgggcgcaggattccgacgaggtgatccgcgggcgg
atgaaaaaggccggcgacgagatgagccatttcgacgcctacgactacatcgtcgtcaac
gacaacatcggcgtcgccttcgagtccgtcaaagcgatcctgcgcgcggaacagctcaag
cgcgagcggcagatcgggatcgacgccttcgtgcgggagatgcggcgcgaactcgaaaaa
tag

DBGET integrated database retrieval system