KEGG   Rhodopseudomonas palustris HaA2: RPB_2482Help
Entry
RPB_2482          CDS       T00321                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPB_2482
   00240 Pyrimidine metabolism
    RPB_2482
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RPB_2482
   03430 Mismatch repair
    RPB_2482
   03440 Homologous recombination
    RPB_2482
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RPB_2482
DNA replication proteins [BR:rpb03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RPB_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2841053..2841505
Genome map
AA seq 150 aa AA seqDB search
MTEVLFYHLQGRTIEQVLPPLLEKSLARGWRVVVQAGSEERADTLDAHLWTYRDDSFLPH
ATWRVADAMHQPIVLTAEESNPNAATVRFLLDNAALPADAEGYERMVLLFDGDDEDAVGM
ARDMWKQSKSRGFEVTYWQADAAGRWQKRE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtcctgttctatcacctgcagggacggacgatcgagcaggtgctgccgccg
ttgctcgagaagtcgctggcgcgcggctggcgggtggtggtgcaggccggctcggaggag
cgcgccgatacgctcgacgcgcatctgtggacctatcgtgacgattcgtttctgccgcac
gcgacctggcgcgtggccgacgcgatgcatcagcctatcgtgctgacagccgaagagagc
aatccgaacgccgccaccgttcggtttctgctcgacaatgcggcgttgccggccgacgcg
gaaggctacgagcggatggtgttgctgttcgacggcgacgatgaagacgccgtcggcatg
gcgcgcgatatgtggaaacagagcaagtcgcgtggcttcgaggtgacctattggcaggcc
gatgccgccggccgatggcaaaagcgggaatag

DBGET integrated database retrieval system