KEGG   Rhodopseudomonas palustris HaA2: RPB_2639Help
Entry
RPB_2639          CDS       T00321                                 

Definition
(GenBank) NusB antitermination factor
  KO
K03625  
N utilization substance protein B
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
Transcription machinery [BR:rpb03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     RPB_2639
Ribosome biogenesis [BR:rpb03009]
 Prokaryotic Type
  rRNA transcription factors
   RPB_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3018911..3019420
Genome map
AA seq 169 aa AA seqDB search
MADSKKPAIKKPVPKGDRKANRRGAARLAAVQALYQMDIGGAGINETFAEFESHWIGNEV
EGDQYLPAEAAFFRDVVSGVVRDQKKLDPLIDDALAKGWPLARIDAILRAVMRAGAYELE
HRKDIPARVVVSEYVDVAHAFVEKDETGMVNAVLDQIARQFREDEFTRG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccgattccaaaaagccggcgatcaagaagccggtcccgaagggcgaccgcaaggcc
aatcggcgcggcgctgcgcggctcgcggccgtgcaggcgctctaccagatggacatcggc
ggtgccggcatcaacgagaccttcgccgagttcgagagccactggatcggcaacgaggtc
gagggtgatcaatatctgccggccgaggccgcgttcttccgcgacgtcgtctccggcgtg
gtgcgcgaccagaagaagctcgacccgttgatcgacgacgcgctggcgaagggctggccg
ctggcgcggatcgacgccatcctccgcgcggtgatgcgtgccggcgcctacgagctcgaa
caccgcaaggatatcccggcgcgcgtcgtcgtctccgaatatgtcgacgtcgcccacgcc
ttcgtcgagaaggacgagacaggcatggtcaacgccgtgctcgaccagatcgcccggcag
tttcgtgaagacgagtttacgcgggggtag

DBGET integrated database retrieval system