KEGG   Rhodopseudomonas palustris HaA2: RPB_2640Help
Entry
RPB_2640          CDS       T00321                                 

Definition
(GenBank) thiamine-monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00730  Thiamine metabolism
rpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RPB_2640
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     RPB_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C HTH_31
Motif
Other DBs
NCBI-ProteinID: ABD07342
JGI: RPB2640
UniProt: Q2IWR8
Position
3019636..3020607
Genome map
AA seq 323 aa AA seqDB search
MPSGEDDLIARYFKPLATDPGALGLVDDAAVLAASRDDLVLTTDAIVEGVHYLPGDPPRA
IARKALRVNLSDLAAKGATPAGFLLTLALRSADERFLAPFAQALGEDAALFDCPLLGGDT
VSTPGPMMISITAIGRVPPGRMVRRNTLCAGDRILVTGTIGDSALGLDLLQGANADISDE
HRAFLIDRYRVPQPRLALAQAIRDHAGAAMDVSDGLAGDLAKMCAASGVTAILDAAAVPL
SAAAQAMISGEPAKLARVLGGGDDYELLCGVAAQQLDPFLAAAQRIGVSVSVIGSAEAGT
GAPRWRDAEHRDIALSGLSYSHF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccctccggtgaagacgatctgattgcccgctacttcaagccgcttgcgaccgatccg
ggcgcgctggggctggtcgacgacgcggcggtgctggcggcgtcgcgcgacgatctggtg
ctgaccaccgacgccatcgtcgagggcgtgcattacctgcccggcgatccgccccgggcc
atcgcccgcaaggcgctgcgggtgaacctgtccgacctcgccgccaagggggcgacgccc
gcggggttcctgctgacgctggcgctgcgcagcgccgacgagcgcttcctggcgccgttc
gcacaggcgctcggcgaggatgccgcccttttcgattgtccgctgctcggcggcgatacg
gtgtccaccccggggccgatgatgatttcgatcaccgccatcggccgggtgccgccgggt
cgcatggtgcggcgcaacacgctttgtgccggggaccggatcctcgtcaccggcacgatc
ggcgactcggcactcggcctcgacctgctgcagggcgcgaatgccgacatctccgacgag
catcgcgcctttctgatcgaccgctatcgcgtgccgcagccgcgtttggccttggcgcaa
gccatacgtgaccatgccggcgcggcgatggacgtgtccgacgggctggcaggcgatctc
gccaagatgtgcgccgcctccggcgtcaccgcgatcctcgacgctgcggccgtcccgctc
tccgctgcggcgcaggcgatgatctcgggcgagccggcgaagctggcccgcgtgctcggg
ggcggtgacgactatgagctgctttgcggcgttgcagcacagcagctcgacccgtttctt
gctgcagcgcagcgaataggggtttcggtcagcgtcatcggctccgccgaagccggaacc
ggagcgccgcgatggcgcgacgccgagcatcgtgacatcgcgctgtcagggctgtcatac
agtcatttctag

DBGET integrated database retrieval system