KEGG   Rhodopseudomonas palustris HaA2: RPB_2643Help
Entry
RPB_2643          CDS       T00321                                 

Definition
(GenBank) HAD-superfamily hydrolase subfamily IA, variant 3
  KO
K01091  
phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_2643
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     RPB_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3023883..3024566
Genome map
AA seq 227 aa AA seqDB search
MKAFFFDLDGTLTDSRTGLHDSFRAAIEAIGVMPLGDAELDLFLGTPLPEMFRTLKADIS
QAGIEAGIDAFRAYYETHGIRQNRAYPGVREMLEALKTRRIPVWVVTSKPQAYAERVIRD
LGFADLVTDVVGAGLAELDTKSDLVKRALGEAGVAPGDAVMVGDRRYDVEGAKANGVVAV
GVTWGYGTREELESAGCDRLVESVSEFCQIFIDRSIVLRTRTAAAAC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttttcttcgacctcgatggcacgctgaccgactcgcggacggggctgcac
gattcgtttcgcgcggcgatcgaagcgatcggcgtgatgccgcttggcgacgccgagctt
gacctgttcctaggcacgcctctgccggagatgttccgaacgttgaaggccgacatcagc
caggccggaatcgaggccggcatcgacgctttccgggcttactacgaaacccacggtatc
cgtcaaaaccgtgcctatcccggagttcgggagatgctggaggctttgaagaccagacgg
attcctgtctgggtcgtgacctccaagccccaggcctatgccgagcgtgtgatccgcgat
ctaggctttgccgatttggtcaccgacgtcgtcggcgcggggctcgcggagttggacact
aaaagcgatctggtgaagcgcgcgctcggcgaagcgggcgtcgcccctggcgatgccgtg
atggtcggagaccggcgctatgatgtcgaaggggccaaggccaatggtgtcgtcgctgtc
ggcgtgacttggggctacggcacgcgcgaagaactcgagtccgcgggctgcgatcgcctc
gtcgagtccgtttcggagttctgtcagatcttcatcgatcgctcgatcgtgcttcgtacc
aggaccgccgccgcggcctgctga

DBGET integrated database retrieval system