KEGG   Rhodopseudomonas palustris HaA2: RPB_2651Help
Entry
RPB_2651          CDS       T00321                                 

Definition
(GenBank) integration host factor, alpha subunit
  KO
K04764  integration host factor subunit alpha
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
DNA replication proteins [BR:rpb03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    RPB_2651
Chromosome and associated proteins [BR:rpb03036]
 Prokaryotic Type
  Nucleoid associated proteins
   IHF (integration host factor)
    RPB_2651
DNA repair and recombination proteins [BR:rpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      RPB_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding DUF4496
Motif
Other DBs
NCBI-ProteinID: ABD07353
JGI: RPB2651
UniProt: Q2IWQ7
Position
3030365..3030736
Genome map
AA seq 123 aa AA seqDB search
MTGTGRTVTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFLVR
QKGQRIGRNPKTGTEVPISPRRVMVFKPSAILKQRINANGTASSMSSSANAAAGDKSESA
SGT
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaccggacgaacagtcacacgtgtcgatctttgtgaggcggtctaccaaaag
gtgggcctgtcacgcacggagtcgtcggcatttgtcgaactggtattgaaagagatcacc
gactgcctcgagaagggcgagacggtgaagctgtcgtcgttcggttcgtttttggtgaga
cagaagggccagcggatcggccgtaatcccaagaccgggaccgaggtgccgatctcgccg
cgccgcgtgatggtgttcaagccgtccgcgatcctcaagcagcgcatcaatgccaacggc
accgcatcgtcgatgtcgtcgtccgccaatgccgcggccggcgacaagtccgaatcggca
tccggcacctga

DBGET integrated database retrieval system