KEGG   Rhodopseudomonas palustris HaA2: RPB_2652Help
Entry
RPB_2652          CDS       T00321                                 

Definition
(GenBank) transcriptional regulator, MerR family
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR HTH_17 HTH_Tnp_1 DUF2007
Motif
Other DBs
NCBI-ProteinID: ABD07354
JGI: RPB2652
UniProt: Q2IWQ6
Position
3030753..3031436
Genome map
AA seq 227 aa AA seqDB search
MDKAPDAFRTISEVADELDIPQHVLRFWETRFTQIKPMKRSGGRRYYRPDDVDLLKGIRR
LLYGEGYTIRGVQRILKEHGIKSVQRLADNEASATFGAVEEAIGRSVAEEDYEPAPGGID
LDDDDYEGENEGLDLHAMMAEPDLRAAAAPARSASQATARRAPAFEDDDDDLPAMASPAP
RLNLPPLDLPPANNAPARPPVDLAPLKAVLQDLIACREALDAAMKDG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaagcgccggatgcattccgaaccatcagcgaagtcgccgacgaactcgacatt
ccgcagcacgtcttgaggttctgggagacgcggttcacccagatcaagccgatgaagcgc
tcgggcggccggcgctactaccggccggacgacgtcgacctgctcaagggcatccgccgg
ctgctgtacggcgaaggctacaccattcgcggcgtccagcggatcctcaaggagcacggc
atcaagtcggtgcagcggctcgccgacaacgaggccagcgccactttcggcgcggtcgag
gaagcgatcggccgcagcgtcgccgaggaagactacgagcccgcgcccggcggcatcgat
ctcgacgacgacgactacgagggcgagaacgagggcctcgacctgcacgccatgatggcg
gaacccgacctgcgcgccgcagcggcaccggcccgctcggccagccaggcaacggcccgt
cgcgcccccgcattcgaggacgacgatgacgacctgccggcaatggcgtcgccggcgcca
cggctgaatctgccgccgctggacctgccgccggcgaataatgccccggcgcgtccgccg
gtcgatctcgccccgctgaaggccgtgctgcaggacctgatcgcctgccgcgaggcgctc
gacgccgcaatgaaggacggctga

DBGET integrated database retrieval system