KEGG   Rhodopseudomonas palustris HaA2: RPB_2664Help
Entry
RPB_2664          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2842 Sensor HlyIII
Motif
Other DBs
NCBI-ProteinID: ABD07366
JGI: RPB2664
UniProt: Q2IWP4
Position
complement(3047933..3048142)
Genome map
AA seq 69 aa AA seqDB search
MNIRTRKLIGTIALLVLAIVWSLVAMAIAQAPVIAESKWLQIVYYVVAGLGWVLPAMPIV
TWMSRPDRQ
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgaacccggaaactgatcggaaccatcgccctgctggttctcgcgatcgtc
tggtcgctggtcgcgatggcaatcgcgcaggcgccggtgatcgccgaatcgaagtggctg
cagatcgtctattacgtcgtcgccgggctcggctgggtgctaccggcgatgccgatcgtg
acctggatgtcgcggcccgaccgtcagtaa

DBGET integrated database retrieval system