KEGG   Rhodopseudomonas palustris HaA2: RPB_2691Help
Entry
RPB_2691          CDS       T00321                                 

Definition
(GenBank) General substrate transporter
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3074952..3076289
Genome map
AA seq 445 aa AA seqDB search
MRAETASHGSALMDATNFVPPATAAGRGRPLNSPAQVLLASLIGTTVEFFDFYVYATAAV
LVFPTLFFPNSDPTTALLASFATFSIAFFARPLGAIVFGHFGDKVGRKTTLVAALLTMGI
STVVIGLLPSYHQIGVLAPLMLALCRFGQGFGLGGEWGGAVLLATENAPDGKRNWYGMFP
QLGAPVGLFLASGVFWLLLHFMSQDALLSWGWRIPFIASIALIAIGLWVRLSITETPEFQ
KAIDKAERVSVPVLEVFRHHKRNMAISTFMALITFVAFYICTAYLLSYNVKVAGVSFRDA
LLVQVYGSVLFGLSTIAAGKLGDRFGRRALLLGSTIILGLFSFALEPLLSAGLVGIYAFT
TVGMLLFGLNYGVIGAALAAPFPTRVRYTGSSITFNMAGIFGASLAPYIATWLQANFGLS
YVGYYQLAAALVSLLCIFAARKAEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgaaaccgcatctcacggatcagcactcatggacgccacaaatttcgtgccc
ccggcaaccgctgccggacgcggcagaccgttgaattcgcccgcgcaggtgttgctggcg
agcctgatcggcaccacggtcgagttcttcgatttctatgtctatgccaccgcggccgtg
ctggtgtttccgacgctgttcttccccaacagcgatccgacgacggcgctgctggcgtcg
ttcgcgacgttctcgatcgcgtttttcgcccgcccactcggcgccattgtgttcggccat
ttcggcgacaaggtcggccgcaagaccacgctggtcgcggccctgctgaccatggggatt
tcgacggtggtgatcggcctgctgccgagctaccaccagatcggcgtgctggcgccgctg
atgctggcgctctgccggttcggccagggcttcggcctcggcggcgaatggggcggcgcg
gtgctgctcgccaccgagaacgcgcccgacggcaagcgcaactggtacggcatgtttccg
caactcggcgccccggtcgggctgtttctggcctccggggtgttctggctgctgcttcac
ttcatgtcgcaggacgcgctgctgagctggggctggcgcatccccttcatcgcctcgatc
gcgctgatcgcgatcggcctgtgggtgcggctgtcgatcaccgagacacccgaattccag
aaggcgatcgacaaggccgagcgcgtctcggtgccggtgctggaagtgttccgccatcac
aagcgcaacatggcgatcagcaccttcatggcgctgatcaccttcgtggcgttctacatc
tgcaccgcatatctgttgtcctacaacgtcaaggtcgccggggtgtcgttccgcgacgcg
ctgctggtgcaggtctacggctcggtgctgttcggcctctcgacgatcgccgccggcaaa
ctcggcgaccgtttcggacgccgtgccctgctcctcggcagcacgatcatcctcggcctg
ttctcgttcgcgctggagccgctgctgtccgctggtctggtcggcatctacgccttcacc
accgtcggcatgctgctgttcggcttgaactacggcgtgatcggcgcggcattggcggcg
ccgttcccgacgagggtgcgctacaccggctcgtcgatcaccttcaacatggccggcatt
ttcggtgcgtcgctggcgccctacatcgcgacctggttgcaggccaatttcggcctgagc
tatgtcggctactatcagttggcggccgcactggtctcgctgctctgcatcttcgccgcg
cgaaaggcggagatctga

DBGET integrated database retrieval system