KEGG   Rhodopseudomonas palustris HaA2: RPB_2712Help
Entry
RPB_2712          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2784
Motif
Other DBs
NCBI-ProteinID: ABD07414
JGI: RPB2712
UniProt: Q2IWJ6
Position
3097091..3097465
Genome map
AA seq 124 aa AA seqDB search
MTTPPIAGTADGRARALIAVRAAHTVIWAFFASSIVLIPIATLLGQLTAALWMSLFVWGE
VVVLLLNGMRCPLTAVAARYTDDRADNFDIWLPRWLARHNQRIFGTLFAASQVLLGYALV
TSGA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccccgccgatcgccggcacggccgacggccgcgcccgggcgctgatcgcggtg
cgcgcggcgcacaccgtgatctgggcgttcttcgccagttcgatcgtgctgatcccgatc
gccaccctgctcggccagctcaccgcggcgctgtggatgagtctgttcgtctggggcgag
gtggtggtgctgttgctgaacgggatgcgctgcccgctgaccgcggtggcggcgcgctac
accgacgatcgcgccgacaatttcgacatctggctgccgcgctggctggcgcggcacaac
cagcggatcttcggcacgctgttcgccgcgagccaggtgctgcttgggtacgcgctggtc
acctccggagcctga

DBGET integrated database retrieval system