KEGG   Rhodopseudomonas palustris HaA2: RPB_2718Help
Entry
RPB_2718          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD07420
JGI: RPB2718
UniProt: Q2IWJ0
Position
3104925..3105293
Genome map
AA seq 122 aa AA seqDB search
MTRLTALTLAITLALLPLAASAASPKKHAKRAQSSGLPGYVQPPSNSVPLFMQKLSRPQR
AMLRPKRPWYIDPTPEYYRWNGGWSGEWRYLGRPGFYRGRYNGGSFGPCWTQTPIGPVWN
CG
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctcaccgccctcacgctcgcaatcaccctcgcgctgcttcccctcgccgcc
tcggcggcttcgcccaagaagcacgccaagcgggcacagagcagcggcctgcccggctat
gtgcagccgccgagcaattcggtgccgctgttcatgcagaagctgtcccgcccgcagcgg
gcgatgctgcggccgaagcggccgtggtacatcgatccaacgccggaatattatcgctgg
aacggcggctggtccggcgaatggcgctatctcggccggccgggcttctaccgcggccgc
tacaatggcggcagcttcgggccttgctggacgcagacgccgatcgggccggtgtggaat
tgcggctga

DBGET integrated database retrieval system