KEGG   Rhodopseudomonas palustris HaA2: RPB_2728Help
Entry
RPB_2728          CDS       T00321                                 

Definition
(GenBank) gid protein
  KO
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     RPB_2728
Transfer RNA biogenesis [BR:rpb03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    RPB_2728
Chromosome [BR:rpb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    RPB_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3111557..3113005
Genome map
AA seq 482 aa AA seqDB search
MIIAAPPPQPASNQPVHVIGGGLAGSEATWQLARAGVRVVLHEMRPHRSTEAHKTDGLAE
LVCSNSFRSDDAANNAVGLLHAEMRRLGSLVMRAADANQVPAGGALAVDRDGFSAAVTKA
LAEHPLIEIRREEIAGLPPEDWGNVIVATGPLTSAALAEAVRALTDESALAFFDAIAPIV
HRDSIDMSIAWFQSRYDKAGPGGSGADYLNCPMNREQYDAFVDALIAGDKVDFKDWEKDT
PYFDGCLPIEVMAERGRETLRHGPMKPVGLTNPHNPTVKAYAIVQLRQDNKLGTLFNMVG
FQTKLNYAAQQRVFRTIPGLENAEFARLGGLHRNTFLNSPKLLDAGLRLRAAPRLRFAGQ
MTGCEGYVESAGIGLVAGLSAAADALGRSMTTPPPTTALGALLGHITGGHIETIDAGPRS
FQPMNINFGLFPPLAQAPTHGPDGKKLRGPEKSVAKKQALSARALADLDAWIAASLKLPA
AA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgccgcgccccctccccaacccgcgtccaaccagcctgttcacgtcatcggc
ggcggcctcgccggctccgaagccacctggcaattggcgcgcgccggcgtgcgcgtcgtg
ctgcacgagatgcggccgcatcgctcgacagaggcgcacaagaccgacggcctcgccgag
ctggtctgctccaattccttccgctccgatgacgccgccaacaacgcggtcgggctgctg
cacgccgagatgcgccggctcggctcgctggtgatgcgcgcggccgacgccaatcaggtc
ccggccggcggcgcgctggcggtcgatcgcgacggcttctccgccgccgtcacgaaggcg
ctggccgagcatccgctgatcgagatccgccgcgaggaaatcgccggcctgccgccggag
gactggggcaacgtcatcgtcgccaccggcccgctgacctcggcggcgctggccgaggcg
gtccgcgcgctgaccgatgaatccgcgctggcgttcttcgacgccatcgccccgatcgtg
catcgcgactcgatcgacatgtcgatcgcctggttccagtcgcgctacgacaaggccggc
cccggcggcagcggcgccgactatctcaactgcccgatgaatcgcgagcagtacgacgct
ttcgtcgacgcgctgatcgccggcgacaaggtcgatttcaaggactgggagaaggacacg
ccgtatttcgacggctgcctgccgatcgaggtgatggccgagcgcggccgcgagacgctg
cgccacgggccgatgaagccggtcgggctcaccaatccgcacaacccgacggtcaaggcc
tacgccatcgtccagctccgccaggacaacaagctcggcacgctgttcaacatggtcggc
ttccagaccaagctgaactacgccgcgcagcaacgcgtcttccgcaccatcccggggctg
gaaaatgctgaatttgcaaggctcggcgggctgcatcgcaacacgtttctgaactcgccg
aagctgctcgatgccggcctgcggctgcgcgccgcgccgcggctgcggttcgccggccag
atgaccggctgcgaaggctatgtcgaatcagccggcatcggtctcgtcgccgggctcagc
gccgccgccgacgcgctcggccgatccatgacgacgccgccgccgaccaccgcgctcggc
gccctgctcggccacatcaccggcggccatatcgagaccatcgacgccggcccgcgctcg
tttcagccgatgaacatcaatttcggcctgttcccgccgctggcgcaggcgccgacccac
ggccccgacggcaagaagctgcgcggcccggaaaagtcggtcgccaagaaacaggcgctc
agcgcccgcgcgctggcggatctggatgcgtggatcgctgcaagcctgaagctaccggcg
gcggcgtag

DBGET integrated database retrieval system