KEGG   Rhodopseudomonas palustris HaA2: RPB_2739Help
Entry
RPB_2739          CDS       T00321                                 

Definition
(GenBank) exopolyphosphatase / 3'-nucleotidase / 5'-nucleotidase
  KO
K03787  
5'-nucleotidase [EC:3.1.3.5]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPB_2739
   00240 Pyrimidine metabolism
    RPB_2739
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RPB_2739
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     RPB_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3123699..3124466)
Genome map
AA seq 255 aa AA seqDB search
MRILCTNDDGIHAPGLKIVEDIARALSDDVWVVAPELDQSGVSHSLSLNDPLRLREVGPR
HFAVRGTPTDCVIMGARHILADKAPDLVLSGVNRGRNVAEDVVYSGTIAGALEGTILGLP
SFALSQEFTLETRNAPLWDTAKAHGPEILRKAIKAGVPKNTVININFPACAPDEVAGVQV
TRQGKRNQGFLRVDERHDGRGNPYFWIGFERVAVVDMPAEGTDLAALAAKYISVTPLRLD
RTDEAFSATLAKTLG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcggattctgtgcaccaatgacgatggcatccatgcgcccgggctcaaaatcgtcgag
gacatcgcccgcgcgctgtccgacgacgtctgggtggtggcgccggaactcgaccagtcg
ggcgtgtcgcattcgctgtcgctgaatgatccgctgcggctgcgcgaagtcggcccgcgg
catttcgcggtgcgcggcacgccgaccgattgcgtgatcatgggcgcgcggcacattctc
gccgacaaggcgcctgatctggtgctgtccggcgtcaaccgcggccgcaacgtcgccgag
gacgtggtctattccggcaccatcgccggcgcgctggagggcaccattctgggcctgccg
tcgttcgcgctgtcgcaggaattcacgctcgagacccgcaacgcgccgctgtgggacacc
gccaaggcgcatggtccggagatcctgcgcaaggcgatcaaggccggcgtgccgaagaac
accgtgatcaacatcaacttcccggcctgcgcgccggacgaggtcgcgggcgtgcaggtg
acgcggcagggcaagcgcaaccagggcttcctgcgcgtcgacgagcgccacgacggccgc
ggcaatccgtatttctggatcggcttcgagcgcgtcgccgtggtcgacatgccggccgaa
ggcaccgatctcgccgcgctggcggcgaagtacatctcggtcacgccgctgcggctcgac
cgcaccgacgaggcgttctccgccacgctggcgaagacgctggggtga

DBGET integrated database retrieval system