KEGG   Rhodopseudomonas palustris HaA2: RPB_2756Help
Entry
RPB_2756          CDS       T00321                                 

Definition
(GenBank) Acriflavin resistance protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: ABD07458
JGI: RPB2756
UniProt: Q2IWF2
Position
complement(3140896..3144024)
Genome map
AA seq 1042 aa AA seqDB search
MTLSELCIRRPVLTTLITASIIAFGIFGYRLLPVSALPKVDFPTIAVTATLPGASADTMA
ASVAGIIERQLSTIAGISSMSSNSSQGTSVITIQFDLGRNIDAAALDVQTALTIAQRRLP
IEMTTPPSFRKVNPAEFPVLFVALSSPTLPLSAVNEYGDITIGQALSQIPGVAQVTIYGA
QKFAIRVQADPEAAAARGLSLEDIRIAVARANSSTPVGTMSGPKQDFALQASGQMDKAVD
YRHIVVAWRNGSPVKLDEVARVYDSVENDRLATWFNGERSIVLAIQKQPDANTVAVVDGV
RAKLPSLRAQIPPSVAMTVMMDRSVSVRQAVFDVQETLAIAVVLVVLVIFLFLRKASATF
IPALAVPISLLGTFAVMYMLDFSINNMTLLALTLSVGFVVDDAIVMLENIMRHVEQGMRP
FDAALKGAREIGFTIISITFSLIAVFIPVLLMGGIVGRVFREFSVTIAVAILVSGFVSLT
LTPMLCARMLKAHDPHKKENIVLRGFETMFSRWLRGYEWALDRVLAHKFLMLMVTFATLG
GTIYLYMVVPKGFFPQEDTGFLIGVTEAATDTSFEAMKDRQLALVEVIKTDPAVDYINST
VGAGGPNATANYGRLFVALKPIKERDPAAKVITRLRQKAGQIPGMQVFFQSIQNLSIGGR
ISKSQYQYVMQSGDTEALYRLAPEMRDKIARLPGLLDVTTDLYIKNPQMTIEIDREKAAV
YGITVDQVRNQLYNAYGARQIGTIYMPSNDYQIILEVQPQFRGDPNDISKLYLKTGNNQT
IPIDAVAKMVPTVGPLQINHQGQQPAVTISFNLAEGQSLGAAVDRITQIEQESNLPVTIV
TGFSGTAQVFQESLRGQGVLILAAVFAAFVILGILYESFIHPITIISGLPSAGIGAILTL
MLFDMELSVIAMIGIVMLVGIVKKNAIMMVDFALERRRVGLSAEHAIREAALLRFRPIMM
TTFAAIFGTLPIALGTGAGAELRQPLGVAVVGGLCVSQLLTLFITPVIYIYLDKIDRKLK
RRLEPQHEELPDGERPRAVAAE
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttccgagctgtgcatccggcggccggttctgaccacgctgatcaccgcgtcg
atcatcgccttcgggatcttcggctatcgactgctgccggtttcggcgttgccgaaagtc
gatttcccgaccattgcggtgacggcgacgcttccgggcgccagcgccgacaccatggcg
gcgtcggtcgccggcatcatcgagcgccagctctcgaccatcgccggcatctcctcgatg
tcgtcgaactcgtcgcagggcacctcggtcatcaccatccagttcgacctcggccgcaat
atcgatgccgccgcgctcgacgtccagaccgcgctgacgatcgcgcagcggcgcctgccg
atcgagatgacgacgcccccgagttttcgaaaagtgaacccggcggagttcccggtgctg
ttcgtggcgttgagttcgccgacgctgccattgtctgcggtcaacgaatacggcgacatc
accatcgggcaggctctgtcgcagattcccggcgtcgctcaggtgacgatctacggcgcg
cagaagttcgccattcgggtccaggccgatccggaagccgctgcggcacgtggattgtcg
ctcgaagacatccgcatcgcggtggcgcgcgccaattcctcgaccccggtcggcaccatg
agcgggccgaagcaggacttcgcgctgcaggcctccggccagatggacaaggcggtcgac
taccgccacatcgtggtggcctggcgcaacggctcgccggtcaagctcgatgaagtcgcc
cgggtctacgacagcgtcgagaacgaccggctggcgacctggttcaacggcgagcgctcg
atcgtgcttgcgatccagaaacaacccgacgccaacaccgtggccgtggtggacggcgtc
cgcgccaagctgccgtcattgcgcgcccagatcccgccctcggtcgcgatgaccgtgatg
atggaccgctctgtgtcggtgcggcaggcggtgttcgacgtccaggagacattggcgatc
gccgttgtgctggtcgtgctggtgatcttcctgttcctgcgcaaggcgtccgcgaccttc
atcccggcgctggcggtgccgatctcgctgctcggcaccttcgccgtgatgtacatgctc
gatttctcgatcaacaacatgacgctgctggcgctgacgctgtccgtcggcttcgtcgtc
gacgacgccatcgtcatgctcgagaacatcatgcgccacgtcgagcaaggcatgcgaccg
ttcgatgcggcgctgaagggggcgcgcgaaatcggcttcaccatcatctcgatcaccttc
tcgctgatcgcggtgttcatcccggtgctgctgatgggcggcattgtcggccgcgtattc
cgcgaattttccgtcaccatcgctgtggcgatcctggtgtcgggcttcgtgtcgctgacg
ctgacgccgatgctgtgcgcgcgaatgctcaaggcgcacgacccgcacaagaaggaaaac
atcgtcctgcgcggcttcgagacgatgttcagccgctggctgcgcggctacgaatgggcg
ctcgaccgcgtgctggcgcacaaattcctgatgctgatggtgaccttcgccacgctcggc
ggcacgatctatctctacatggtcgtgcctaaagggttctttccgcaggaagataccggc
ttcctgatcggcgtcaccgaggccgcgaccgacacctcgttcgaggcgatgaaggatcgc
cagctcgcgctggtcgaggtcatcaagaccgatccggctgtcgactacatcaacagcacg
gtcggcgccggcggcccgaatgccaccgcgaattacggccggctgttcgtcgccctgaag
ccgatcaaagagcgcgatccggccgccaaggtgatcacgcgtttgcggcagaaggccgga
cagatccccggaatgcaggtgttcttccagagcatccagaatctgtcgatcggcggccgc
atttccaaaagccagtatcaatatgtgatgcagagcggcgacaccgaggcgctgtaccgc
ctcgccccggagatgcgtgacaagatcgccagattgccgggcctgctcgacgtcaccact
gatctttacatcaagaacccgcaaatgacgatcgagatcgaccgcgaaaaggcggccgtc
tatggcatcaccgtcgatcaggtgcgcaaccagctctacaacgcctacggtgcacggcag
atcggcacgatctacatgccgtcgaacgactatcagattatcctcgaggtgcagccgcag
ttccgcggtgatccgaacgacatctcgaagctctatctcaagaccggcaacaaccagacc
attccgatcgacgcggtggccaagatggtgcccaccgtcggcccgctgcagatcaatcac
cagggtcagcagcccgcggtgacgatctcgttcaatctcgcggaaggccagtcgctcggc
gccgcggtcgatcgcatcacccagatcgagcaggagtccaatttgccggtcacgatcgtg
accgggttctccggcacggcccaggtgtttcaggaaagtctgcgcgggcagggcgtgttg
atcctcgccgcagtgttcgcggcgttcgtgatcctcggcatcctgtacgagagcttcatc
cacccgatcaccatcatctccggcctgccgtcggccggtatcggcgcgatcctgacgttg
atgctgttcgacatggagctctcggtgatcgcgatgatcggcatcgtgatgctggtcggt
atcgtcaagaagaatgcgatcatgatggtcgatttcgccctggagcggcggcgcgtcggg
ctgtcggccgagcacgccatccgcgaggcggcactgctgcggttccgaccgatcatgatg
acgaccttcgccgcgatcttcggcacgctgccgatcgcgctcggcaccggcgctggcgct
gagctgcgtcagccgctcggcgtcgccgtggtcggcgggctgtgcgtttcgcaattgctg
acgctgttcatcaccccggtgatctacatctatctcgacaagatcgatcgcaagctgaag
cgccggctcgagccgcagcacgaggaattgcccgacggcgagcgcccgcgggcggtggcg
gcggaatga

DBGET integrated database retrieval system