KEGG   Rhodopseudomonas palustris HaA2: RPB_2795Help
Entry
RPB_2795          CDS       T00321                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rpb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpb00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rpb00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rpb00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rpb00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3185514..3186299)
Genome map
AA seq 261 aa AA seqDB search
MRVSMPVPAVRSLIAGNWKMNGLKAASSELDAILEGAAQLSSGVDLLVCPPATLIAAFAD
RLAAHANSALPVAIGAQDCHTNAAGAHTGDISAEMLADAGARTIIVGHSERRADHAETDA
IVRTKAQAVWRAGLVAIVCVGETQGERNAGHTLDVVAGQLAGSLPDGATAANLVVAYEPV
WAIGTGMTPTAADVEEVHGFIRQTLTQRFNGEGERMRLLYGGSVKPSNASELMAVPHVNG
ALVGGASLKASDFLAIAAGCP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgtccatgccggtccccgccgttcgttcgctgattgccggaaactggaagatg
aacggcctcaaggccgcttcgtctgaactcgatgcgatcctggaaggcgcggcgcaactt
tcgtcgggggtcgatctgctggtatgcccgcccgcgacgctgattgcggcgttcgccgat
cggctcgcggcccacgccaacagcgcgctgccggtcgcaattggtgcacaggattgccac
accaatgccgcaggcgcacataccggcgacatctcggccgaaatgctggcggatgccggc
gcccgcactattatcgtcggccattccgagcgccgcgccgaccacgccgagaccgacgcg
atcgtccgcaccaaggcgcaggcggtctggcgggcagggttggttgcgatcgtctgcgtt
ggcgaaacccaaggtgagcgcaatgccggccacaccctcgatgtggtcgccggccagctc
gccggctcgctgccggacggcgcaaccgccgccaatctggtggtggcctatgagccggtc
tgggcgatcggcaccggcatgacgccgactgccgcagatgtcgaggaagttcatggattt
atccgccagactctgacgcaacgcttcaacggcgagggcgagcgcatgcggttgctttac
ggcggttcggtgaagccctccaacgccagcgagctgatggcggttccccacgtcaacggc
gcgctggtcggtggcgccagcctgaaggcgtcggacttccttgcgatcgcggccgggtgc
ccctga

DBGET integrated database retrieval system