KEGG   Rhodopseudomonas palustris HaA2: RPB_2895Help
Entry
RPB_2895          CDS       T00321                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPB_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 MTS Methyltransf_31 Methyltransf_11 DUF2920 Methyltransf_24 IPPT RrnaAD
Motif
Other DBs
NCBI-ProteinID: ABD07597
JGI: RPB2895
UniProt: Q2IW13
Position
complement(3297051..3297719)
Genome map
AA seq 222 aa AA seqDB search
MSDFARARLNMVDGQIRPHSVTDWRIIDAMRVVPREAFVRDDQKCLAYLDQDIDLDGTGG
DFRHVLLDPTVTARLLQSAEIGHGENVLVVGGATGYVAALVAKLADRVVTTVDDEAMAAQ
ARATLAELGLANVTVRVAPCGEGAPADAPFDVIILNGATEIEPTGLYDQLKLNGRLVGAF
ATERPQRATVITRSHCDFGSRVLFDTSVPVLPGLRRVPTFVF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatttcgcacgcgcacgcttgaacatggtcgacggtcagatccggccgcacagc
gtgacggactggcgaatcatcgatgcgatgcgggtggtcccgcgtgaggcgttcgtgcgg
gacgatcagaagtgtctggcctatctcgaccaggacatcgatctcgacggaaccggcggc
gactttcgccatgtgctgctcgatccgaccgtgacggcacggctgctgcaatcggccgag
atcggccatggcgagaatgtcctggtggtcggcggcgccaccggctacgtcgccgcgctg
gtcgccaagctggcggatcgggtcgtcaccacggtcgacgacgaagcgatggccgcgcag
gcgagggcgactctcgccgaactcggactggccaatgtgacggtccgcgtcgcgccgtgc
ggcgaaggcgcgccggccgacgcgccgttcgacgtcatcatcctcaacggcgccaccgaa
atcgagccaaccgggctgtacgaccagctgaagctcaacggccgtctggtcggggcattc
gccaccgagcggccgcagcgggccaccgtgatcacccggtcgcattgcgatttcggatcg
cgggtgctgttcgatacctcggtcccggttttgccgggccttcgacgggttccaaccttc
gttttctag

DBGET integrated database retrieval system