KEGG   Rhodopseudomonas palustris HaA2: RPB_2986Help
Entry
RPB_2986          CDS       T00321                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3401005..3402063
Genome map
AA seq 352 aa AA seqDB search
MQNDHERSMAYAELALNQIRALRQGAMPRNYEIWYVYATGYNAELNKAINEALAQNGRLS
DADLEQLHDSYLSHGRTHERIDRIGARVVNEIDDMMSLLSDALGTTATFGDNLQGASQNL
SIATDHEQIKAIIERLVGSTREMQQANHALEERLSSSRQEITNLQASLEAISAESLTDPL
TGLGNRKHFDRVVTEAVRSATVSRLPLSLLMMDIDHFKSFNDNYGHLTGDQVLRLVGMTL
KQSIKTKNVPARYGGEEFAVVLPDTPLRQALMVADDIRRVVMSKELKKKSTGEILGRVTL
SAGVSTLKPDDDADALIERADACLYSAKRNGRNRVICETDPEFRSVAPAKVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgaccacgaacgcagcatggcgtatgccgagctggcgctgaaccagatccgg
gcgctgcggcagggcgcgatgccgcgcaactacgagatctggtacgtctacgccaccggc
tacaacgccgagctcaacaaggcgatcaacgaggcgctggcccagaacggccggctgtcg
gacgccgacctcgagcagctacacgatagctatttgtcgcacggccgcacccacgagcgc
atcgaccggatcggcgcccgcgtcgtcaacgagatcgacgacatgatgtcgctgctgtcc
gatgcgctcggcaccaccgcgacgttcggcgacaacctgcagggcgcgagccagaacctg
tcgatcgccaccgaccacgagcagatcaaggcgatcatcgagcggctggtcgggtcgacc
cgcgagatgcagcaggccaaccacgccctcgaagagcggctgtcctcgtcgcggcaggaa
atcaccaatctgcaggccagcctcgaggcgatcagcgccgagagcctgaccgatcccttg
accggcctcggcaaccgcaagcatttcgaccgcgtcgtcaccgaagcggtgcgcagcgcc
acggtgagccggctgccgctgtcgctgctgatgatggacatcgatcacttcaagtcgttc
aacgacaattacggccacctcaccggcgatcaggtgctgcggctggtcggcatgacgttg
aagcagagcatcaagaccaagaacgtcccggcgcgctacggcggcgaggaattcgccgtg
gtgctgccggacacgccgctgcgccaggcgctgatggtcgccgacgacatccgccgcgtg
gtgatgtcgaaggaattgaagaagaagtcgaccggcgagatcctcggccgggtgacgctg
tcggccggcgtctcgacgctgaagccggacgacgacgccgacgcgctgatcgaacgcgcc
gacgcctgcctgtattcggccaagcgcaacggccgcaaccgggtgatctgcgaaaccgat
cctgaattccgcagcgtcgcgcccgccaaggtcgcgtag

DBGET integrated database retrieval system