KEGG   Rhodopseudomonas palustris HaA2: RPB_3142Help
Entry
RPB_3142          CDS       T00321                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rpb00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3594318..3596264
Genome map
AA seq 648 aa AA seqDB search
MTDNTKDHGVSRRTLLGTTAAAAGVGLAGGIAFTTDGNQLIGTADAQTKAAPTLPARPAI
HKAEVAPGELDEYYVFFSSGQTGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKVL
TEGLLPETREFLKTRGGTYVNGDLHHPHLSFTDGTYDGRYAFMNDKANTRVARVRLDVMK
CDKIIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLVNDGKILDKPKEYHAIFTAVDGD
TMKVAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVNAAEMTASEQDWVVIFNLKRIEE
GVKKGDFKEMGGVPVLDGRKGSPYTRYVPISNSPHGMNTAPDGIHIVANGKLSPTATVMD
VRLFDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNAYTTLFIDSQICKWNIDLAKRA
FKGEKVSPILQKLDVHYQPGHNHTSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQ
LIDISGDKMKLVHDGPSFAEPHDATIVHRSKINPISIWDRADPMFSDAIKQAKADGIKLE
EESKVIRDGNIVRVYMTSQAPSFGLEHFQVKQGDQVTVYVTNIDSVEDLTHGFSIINYGI
NMEVAPQATASVSFSADKAGVYWYYCSWFCHAMHMEMKGRMFVEPKTA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaacaccaaggatcacggcgtcagccgacgcaccttgctcggaaccactgcc
gcggcggccggcgtcggcctcgccggtggcatcgcattcaccaccgacggcaatcagctg
atcgggaccgccgatgcccagaccaaggccgcgccgacgcttcccgcgcgcccggcgatc
cacaaggccgaggtcgcccccggcgagctcgacgaatactacgtgttcttctcgagcggc
cagaccggcgaattgcggatcgtcgggctgccctcgatgcgcgaactgatgcgcgtgccg
gtgttcaaccgctgcagcgccaccggctggggccagaccaacgaaagcctcaaagttttg
accgagggcctgctgccggagacccgcgaattcctcaagactcgcggcggcacttatgtg
aacggcgatctgcaccacccgcatctgtcgttcaccgacggcacctatgacggccgctac
gccttcatgaacgacaaggccaacacccgcgtcgcccgcgtccggctcgacgtgatgaaa
tgcgacaagatcatccagttgccgaaccagcacaccgtgcacggcctgcgcgtgcagaaa
tatccgcgcaccggctacgtgttctgcaacggcgaggaccgcgtgccgctggtcaacgac
ggcaagatcctcgacaagccgaaggaataccacgcgatcttcaccgcggtcgacggcgac
accatgaaggtggcctggcaggtgatggtcgacggcaatctcgacaacgtcgatgccgac
tatcagggcaaatacgcattcgcgacctgctacaattctgaggaaggcgtcaacgccgcg
gaaatgaccgcgagcgagcaggactgggtcgtcatcttcaatctcaagcggatcgaagag
ggcgtgaagaagggcgacttcaaggagatgggcggcgttccggtgctcgacggccgcaag
ggatcgccctacacccgctacgtcccgatctccaacagcccgcacggcatgaacaccgca
cccgacggcatccacatcgtcgccaacggcaagctgtcgccgaccgcgacggtgatggac
gtgcggctgttcgatcagttgttcgacgacaagatcaagccgcgcgacgtcgtggtggcg
gagccggagctcggcctcggcccgttgcacaccgcctatgacggcaagggcaacgcctac
accacgctgttcatcgacagccagatctgcaagtggaacatcgatctggcgaagcgcgcc
ttcaagggcgagaaggtcagtccgatcctgcagaagctcgacgtccactatcagcccggc
cacaaccacacctcgatgggccagaccaaggaagccgacgggaaatggctgatctcgctg
aacaagttctcgaaggatcggttcctcaatgtcgggccgctgaagccggagaacgaccag
ctcatcgacatctccggcgacaagatgaagctggtgcacgacggcccgagcttcgccgag
ccgcatgacgccaccatcgtgcatcgttccaagatcaacccgatctcgatctgggaccgc
gccgatccgatgttctccgacgcgatcaagcaggccaaggccgacggcatcaagctggaa
gaggagtccaaggtgatccgcgacggcaacatcgtgcgggtctacatgacctcgcaagcg
ccgtcgttcgggctcgagcacttccaggtcaagcaaggcgatcaggtcaccgtctacgtc
accaacatcgactccgtcgaggatctcacccacggcttctcgatcatcaactacggcatc
aacatggaggtggcgccgcaagccacggcctcggtgtcgttctcggccgacaaggccggg
gtgtattggtactactgctcctggttctgccacgccatgcacatggagatgaagggccgg
atgttcgtcgagccgaagacggcctga

DBGET integrated database retrieval system