KEGG   Rhodopseudomonas palustris HaA2: RPB_3533Help
Entry
RPB_3533          CDS       T00321                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00790  Folate biosynthesis
rpb01100  Metabolic pathways
Module
rpb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPB_3533
Enzymes [BR:rpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RPB_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABD08228
JGI: RPB3533
UniProt: Q2IU82
Position
4045003..4045869
Genome map
AA seq 288 aa AA seqDB search
MSAAQQTPAPPTATGAAALRALLARPVPVVMGILNVTPDSFSDGGDFLGPERARAHAARM
IADGADIIDIGAESTRPYGSTPVSADEERRRLAPVLAAVAALGAPVSIDSMKAEVVAWAL
DHGAAIANDVWGLQRDPAMAEVVAARGAPVIVMHNRDDADPSIDIVADINAFFERSLAIA
ARAGIAEHSIVLDPGIGFGKTPQQSMIALARLGAFAHFGLPVLVGASRKRFISTVAPSEP
KQRLGGSIAAHLIAMENGARIIRAHDVADTAQALKVAHAIRTSSEDRR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcgcagcaaaccccagcgcctcccaccgcgaccggcgccgccgcgttgcgg
gcgctgctggcgcgcccggtgccggtggtgatgggcattctcaacgtcacccccgattcg
ttctccgacggcggcgactttctcgggcccgagcgggcgcgggcgcatgcggcgcggatg
atcgcggacggcgccgacatcatcgacatcggcgccgagagcacccgcccctacgggtcg
acgccggtctcggccgacgaggagcggcggcggctggcgccggtgctggcggcggtcgca
gcactcggcgcgccggtgtcgatcgacagcatgaaggccgaggtggtggcctgggcgctc
gaccatggggctgcgatcgccaacgacgtctggggcctgcagcgcgatccggcgatggcg
gaggtcgtcgcggcgcgcggcgcgccggtgatcgtgatgcataatcgcgacgacgccgac
ccgtcgatcgatatcgtcgctgatatcaacgcgttcttcgaacgctcgctggcgatcgcc
gcccgcgccggcatcgccgagcacagcatcgtgctcgatcccggcatcggcttcggcaag
acgccgcagcagagcatgatcgcgctggcgcggctgggcgccttcgcgcatttcggcctg
cccgtgctggtcggcgcctcgcgcaagcgtttcatcagcacggtggcgccgtcggaaccg
aagcagcggctcggcggttcgatcgccgcgcatctcatcgcgatggagaacggcgcgcga
atcatccgcgcccacgacgtcgccgacaccgcgcaggcgctcaaagtcgcgcacgcgatc
aggaccagcagcgaggacagacgatga

DBGET integrated database retrieval system