KEGG   Rhodopseudomonas palustris HaA2: RPB_3535Help
Entry
RPB_3535          CDS       T00321                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPB_3535
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RPB_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4046236..4046727
Genome map
AA seq 163 aa AA seqDB search
MAEALIALGGNVGDVRATFDKAIANICGMTQGELLARSSDYATPPWGDEQQERFVNACVA
IDTALDPHALLFTLHKIEKRFGRDRAQERRWGPRTLDLDLLSYDDAVINQPGLTLPHPRL
FERAFVLVPLVEIRPDGLVGGRSLQDALAGLSTAGIERLPDRV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcgctgatcgcgctcggcggcaatgtcggcgacgtccgcgcgacgttcgac
aaggcgatcgccaatatctgcggcatgacgcagggcgaactgctcgcccgctcgtcggac
tacgcgaccccgccctggggcgacgaacagcaggagcgcttcgtcaatgcctgcgtggcg
atcgacaccgcgctcgatccgcacgcgttgttatttacgctgcacaagatcgagaagcgc
ttcggccgcgaccgcgcgcaggagcgccgctggggtccgcgcacgctcgacctcgatctg
ctgagttacgacgatgcggtgatcaatcagcccggcctgacgctgccgcatccgcgtctg
ttcgagcgcgccttcgtgctggtgccgctggtcgagatccggccggacggattagtcggc
ggccgatcgctgcaagacgccctcgctggtctgtccaccgccgggatcgagcggctgccg
gaccgcgtctga

DBGET integrated database retrieval system