KEGG   Rhodopseudomonas palustris HaA2: RPB_3557Help
Entry
RPB_3557          CDS       T00321                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RPB_3557
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPB_3557
   00650 Butanoate metabolism
    RPB_3557
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_3557
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPB_3557
   00310 Lysine degradation
    RPB_3557
   00360 Phenylalanine metabolism
    RPB_3557
   00380 Tryptophan metabolism
    RPB_3557
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPB_3557
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPB_3557
   00281 Geraniol degradation
    RPB_3557
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPB_3557
   00627 Aminobenzoate degradation
    RPB_3557
   00930 Caprolactam degradation
    RPB_3557
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPB_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4070564..4071343
Genome map
AA seq 259 aa AA seqDB search
MSTFEFIIVERQNAVGIIKLNRPKLLNALSFGVFGEIGAAVDDLEADDAIGCILITGSDK
AFAAGADIKEMQPKGFIDMFNEDFTSIGGDRLARCRKPTIAAVAGYALGGGCELAMMCDI
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKSKAMDLCLTGRMMDAQEAERAGLVSR
IVPADKLMEEALAAAEKIASMSYPAAAMAKSAVNRALETTLAEGLAVERDLFRSSFALED
RSEGMAAFIEKRKPNNKNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttttgaattcatcatcgtcgaacgccagaacgccgtcggcatcatcaagctc
aaccgtccgaagctgttgaacgcgctgtcgttcggtgtgttcggcgagatcggcgcggcg
gtcgatgatctcgaagccgacgacgcgatcggatgcatcctgatcaccggcagtgacaag
gcgttcgccgccggcgccgatatcaaggagatgcagccgaagggcttcatcgacatgttc
aacgaggacttcacctcgatcggcggcgaccgtctggcgcgctgccgcaagccgaccatc
gccgcggtcgccggctacgcgctcggcggcggctgcgaattggcgatgatgtgcgacatc
atcatcgcggccgacactgcgaagttcggccagccggaaatcaccctcggaacaatcccg
ggcattggcgggacgcagcgcctgacgcgcgccatcggcaagtcgaaggcgatggatctg
tgcctcaccggacggatgatggatgcgcaggaagccgaacgcgccggcctggtcagcagg
atcgtgcccgccgacaagctgatggaagaggcgctcgccgccgccgagaagatcgcgtcg
atgtcgtatcctgcggccgcgatggcgaaaagcgcggtgaaccgtgcgctggaaaccaca
ctggccgaaggtctcgcggtcgagcgcgatttgttccgctccagcttcgcactcgaagat
cgctccgagggcatggcggccttcatcgaaaagcgcaaaccgaacaacaagaaccgctga

DBGET integrated database retrieval system