KEGG   Rhodopseudomonas palustris HaA2: RPB_3645Help
Entry
RPB_3645          CDS       T00321                                 

Definition
FAD-binding oxidoreductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_3645
  Amino acid metabolism
   00380 Tryptophan metabolism
    RPB_3645
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RPB_3645
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RPB_3645
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RPB_3645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4180778..4183996)
Genome map
AA seq 1072 aa AA seqDB search
MSSSNKLAPIPHPPKQPVVGNMLSIDTKAPVQHLVRLAEELGPIFWLDMMGAPIVIVSGY
DLVDEISDEKRFDKAVRGALRRVRTVGGDGLFTADTSEPNWSKAHNILLTPFGGRAMQSY
HPSMVDIAEQLVKKWERLNADDEIDVVHDMTALTLDTIGLCGFDYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPLENLWMKKRRDTLAEDVAFMNAMVDEIIAERRKAAAVADKMDML
GAMMTGVDKVTGEPLDDVNIRYQINTFLIAGHETTSGLLSCAIYALLKHPEVLQKAYDEV
DRVLGADTSVEPSYQQVNQLGYITQILKETLRLWPPAPAYGVAPIQDETIGGQYHLKRGT
FTTVLVLALHRDPSIWGPNPDAFDPENFSREAESKRPANAWKPFGNGQRACIGRGFAMHE
AALALGMILQRFKLIDHTRYRMVLKETLTIKPEGFKIKVRPRSDKDRATRIASGVSHSVA
PAPAAPRARPGHNTPLLVLYGSNLGTAEELAHRVADLADLNGFATRLGALDQYVGQLPEE
GGVLIFAASYNGAPPDNATQFVRWLSGDLPPDAFAKLRYAVFGCGNRDWTATYQAIPRLI
DERLAAHGGRNIFVRGEGDARDDLEGQFEAWFATLGPLAVKEFGIDAAFDRGADDTPLYG
IEPLAPAASQPLAATGVAVAMRVLENRELQDRAASGRSTRHIEIALPQGMSYRVGDHLSV
IPRNDPALVAAVAQRFGFAPDDQIRLSAAPGRRAQLPVGEAVSIGGLLGDHVELQQVATR
KQIVALAAHTRCPQTRPKLQALAGGDGAADDAYRAEVLGKRRSVFDLLQEHPACELPFAA
YLEMLTPLQPRYYSISSSPARDPARASVTVAVVEGPALSGRGIYRGACSSWLAGRGSGDT
VQATVRATKACFRLPDDDRVPLIMIGPGTGVAPFRGFLQERSARKVGGATLGPALLFFGC
RHPAQDYLYADELQGFAADGIVELHAAFSRGDGPKTYVQHLIAAQKDRVFALIEQGAIVY
VCGDGGRMEPDVKAALCAIHRERSGADATAAAAWIADLGARDRYVLDVWASV
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtccaacaagctcgcgccgattccgcatccaccgaagcagccggtggtcggc
aacatgctgtcgatcgacaccaaggcgccggtgcagcatctggtgcgtctcgccgaggaa
ctcgggccgatcttctggctcgacatgatgggcgcgccgatcgtgatcgtgtcgggctac
gatctggtcgacgagatcagcgacgagaagcgtttcgacaaggcggtgcgcggcgcgctg
cgtcgggtccgtacggtcggcggcgacgggctgttcacggccgacaccagcgagccgaac
tggagcaaggcacacaacatcctgctgacgccgttcggcggccgtgccatgcagtcgtat
catccgagtatggtcgatatagccgagcagctcgtcaaaaaatgggagcgtctcaacgcc
gacgacgagatcgacgtcgttcacgacatgaccgcgctgacgctcgacaccatcggcctg
tgcggcttcgactatcgcttcaattcgttctatcggcgcgactaccaccccttcgtggaa
tcgctggtgcgctcgctcgagaccatcatgatgacccgcggcctgccgctggaaaatctc
tggatgaagaagcggcgcgacacgctggccgaagacgtcgccttcatgaatgcgatggtc
gacgagatcatcgccgagcgacgcaaggcggccgccgtcgccgacaagatggacatgctc
ggcgcgatgatgaccggcgtcgataaggtcaccggcgagccgctcgacgacgtcaacatc
cgctatcagatcaacaccttcctgatcgccggccacgagaccaccagcgggctgctgtcc
tgcgcgatctatgcgctgttgaagcatcccgaggttttgcagaaggcctatgacgaggtc
gaccgcgtgctcggcgccgacacgtcggtcgagccgagctatcagcaggtcaatcagctc
ggctatatcacccagattctcaaggagacgctgcggctatggccgccggcgccggcctac
ggcgtggcgccgatccaggacgagaccatcggcggccaatatcatctgaaacgcggcacc
ttcaccacggtgctggtgctggcgctgcatcgcgacccgagtatctggggtccgaatccg
gatgcgttcgacccggagaatttttcgcgcgaggcggaatccaagcgcccggccaatgcg
tggaaaccgttcggcaacggccagcgcgcttgcatcggccgcggctttgcgatgcacgag
gcggcgctggcgctcggcatgatcctgcaacgcttcaagctgatcgatcacacgcgctat
cgcatggtgctgaaggaaacgctgacgatcaagccggagggcttcaagatcaaggtgcgg
ccccgcagcgacaaggatcgagccacgcggatcgcgtcgggagtatcgcactctgtggcc
ccggccccggccgcgccgcgcgcgcggccgggccacaacacgccgctgctggtgctgtac
ggctccaatctcggcaccgccgaggagctggcgcaccgcgtcgccgatctcgccgacctg
aacggcttcgcgacgcgactcggcgcgctcgatcagtatgtcggtcagttgccggaagag
gggggcgtactgatcttcgccgcctcctacaacggcgcgccgccggacaacgccacgcag
ttcgtgcgctggctgtcgggcgatttgccgcccgatgcctttgccaagctgcgctatgcc
gtgttcggctgcggcaatcgcgactggaccgcgacctatcaggcgatcccgcggctgatc
gacgagcgcctcgccgcgcatggcggccgcaacatcttcgtgcgcggcgagggcgacgcc
cgtgacgatctcgaaggccagttcgaggcctggttcgccacgctcggcccgctggcggtg
aaggagttcggcatcgacgctgcgttcgatcgcggtgccgacgatacgccgctgtatgga
atcgagcccctcgcgccggcggcgtcgcagccgctggccgccactggcgtcgcagtggcg
atgcgcgtgctggagaaccgcgagctgcaggatcgcgcagcctccggccgctcgacccgg
cacatcgagatcgcattgccgcagggcatgagctaccgcgtcggggatcatctcagcgtg
atcccgcgcaacgatccggcgctggtcgccgccgtcgcgcagcgcttcggctttgcgccc
gacgaccagatcagattgtcggcggcgcccgggcgccgcgcgcaattgccggtgggtgaa
gccgtgtcgatcggcggcctgctcggcgaccatgtcgaactgcagcaggtggccacccgc
aagcagatcgtggcgctggccgcgcacacgcgctgtccgcagacgcgaccgaagctgcag
gcgctcgccggcggcgacggcgcggccgacgatgcctatcgcgcggaggtactgggtaag
cgccggtcggtgttcgatctcttgcaggaacatcccgcttgcgagttgccgttcgcggcc
tatcttgaaatgctgacgccgctgcagccgcgttactactcgatctcgtcgtcaccggcg
cgagatccggcgcgggcctcggtcaccgtcgcggtggtcgagggaccggcgctgtccggc
cgtggcatctatcgcggcgcgtgctcgagctggctcgccggccgcggcagcggcgatacc
gttcaggccacggtacgtgcgaccaaggcctgcttccgtctgccggacgacgatcgcgtg
ccgttgatcatgatcgggccgggcaccggggtggcgccgttccgcggctttctacaggag
cgttccgcgcgcaaggtcggcggcgcaacgctcggcccagcgctgctgttcttcggttgc
cgccatccggcgcaggactatctctatgccgacgaattgcagggcttcgcggccgacgga
atcgtcgaattgcacgccgcgttctcgcgcggcgacgggcccaagacctatgtgcaacat
ctgatcgccgcgcaaaaggatcgggtgttcgcattgatcgagcagggcgcgatcgtttat
gtctgcggcgacggcggccggatggagccggatgtcaaggccgcgctgtgtgcgatccat
cgcgagcgcagcggcgccgacgcgacggccgccgcggcatggattgcggatctcggcgcg
cgcgatcgctacgtgctcgatgtttgggcgagcgtgtaa

DBGET integrated database retrieval system