KEGG   Rhodopseudomonas palustris HaA2: RPB_3714Help
Entry
RPB_3714          CDS       T00321                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPB_3714
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_3714
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPB_3714
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPB_3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4252697..4254061)
Genome map
AA seq 454 aa AA seqDB search
MSDQIKYVLDEENIPKSWYNLNADFPKPVPDVLHPGTHQPVGPSDLEPLFPMELILQEVA
TDRYIDIPAPVRDVFRMWRPSPLVRARRLEQALGTPAKIYYKYEGVSPAGSHKPNTAVPQ
AWYNKEAGIKKLSTETGAGQWGSSLAFAGSLFGLDVLVFQVRVSFDQKPYRRALMETYGA
RCIASPSTETESGRAILAQHPDSPGSLGIAISEAVEVAAKNPDIKYALGSVLNHVMLHQT
IIGQEAIKQCEMAGDDPDVIIGCAGGGSNFAGLAFPFLGLQLRGGRSRRIIAVEPAACPT
LTRGTYAYDFGDTAHLTPLVKMHTLGSTFIPPGFHAGGLRYHGMSGMVSHAYELGLIEAR
AYHQVKCFEAGVQFARNEGIVPAPESTHAVRCAIDEALRCKAEGKAETILFNLSGHGHFD
MQAYINYYEGKLVDVDYNEADLATALAGLPAVAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagatcaagtacgtcctggacgaggagaacatcccgaagtcctggtacaat
ctcaatgccgactttcccaagccggtacccgacgtgctgcatccgggcacgcatcagccg
gtcggcccgtccgatctggagccgctgtttccgatggagctgatcctccaggaggtcgcc
accgatcgctacatcgacattcccgcgccggtgcgcgacgtgttccggatgtggcggccg
tcgccgctggtgcgtgcgcgccgcctcgagcaggcgctcggcacgccggccaagatctac
tacaaatacgaaggcgtctcgccggccggctcgcacaagccgaacaccgcggtgccgcag
gcctggtacaacaaagaggccggcatcaagaagctgtcgaccgagaccggtgccgggcag
tggggctcgtcgctggccttcgccggctcgctgttcgggctcgacgtgctggtgttccag
gtccgcgtctcgttcgaccagaaaccgtatcgccgcgcgctgatggaaacctacggcgcg
cgctgcatcgcctcgccctcgaccgagaccgagtccggccgcgccatcctggcgcagcat
cccgacagccccggctcgctcggcatcgcgatctccgaagccgtcgaagtcgcggcgaag
aatccggatatcaaatacgcgctcggctcggtgctcaatcacgtcatgctgcaccagacc
atcatcggccaggaagcgatcaagcagtgcgaaatggccggtgacgatcccgacgtgatc
atcggctgcgccggcggcggctcgaatttcgcaggccttgcgttcccgttcctcggcctg
cagctgcgcggcggccggtcgcggcggatcatcgcggtcgagcccgcggcgtgcccgacg
ctgacgcgcggcacctacgcctatgatttcggcgacaccgcgcatctgacgcccttggtg
aagatgcacacgctgggctcgaccttcattccgccgggcttccacgccggcggcctgcgc
tatcacggcatgagcgggatggtgtcgcacgcctacgagctcggcctgatcgaggcgcgt
gcctatcaccaggtgaagtgcttcgaagccggcgtgcagttcgcccgcaacgagggcatc
gtgccggcgccggaatcgacccacgcggtgcgctgcgcgatcgacgaggcgctgcgctgc
aaggcggagggcaaggcggagacgatcctgttcaacctctcgggtcacggccatttcgac
atgcaggcctacatcaactactacgaaggcaagctcgtcgacgtcgactacaacgaagcc
gacctcgcgaccgcgctggcgggcctgccggcggtggcggcttag

DBGET integrated database retrieval system