KEGG   Rhodopseudomonas palustris HaA2: RPB_3917Help
Entry
RPB_3917          CDS       T00321                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rpb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4468960..4470126)
Genome map
AA seq 388 aa AA seqDB search
MSVALAGSPAINATQYEPLRVMVVDDSVVIRGLISRWIEAEPDMVVAASLRTGLDAVNQV
ERIKPDIALLDIEMPELDGIAALPQLLAKKRDLIVIMASTLTRRNAEISFKALSLGAADY
IPKPETTRESAGAEVFRHDLLQKIRHLGGKVRRRVSAPSASAPMVARVREAAAAPAAPSV
ASQAALVKRAFGPTAPRVLLIGSSTGGPQALMSLVAEIGPVIDRYPVLITQHMPPTFTTI
LAEHLMRAARRPAHEGVDGELIKPGRIYLAPGGRHMRVTRQGGQPAIALDDGPAVNFCKP
AVDPLFTSAIDVWQGGIMAVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAA
ANAGICAAVLPLNQIGPKLVRLFSGDRS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagctctggcaggaagtccggccatcaatgcgacgcagtatgaaccgctgcgg
gtgatggtcgtcgacgattcggtggtgattcgcgggctgatctcgcgttggatcgaggcc
gagcccgacatggtcgtcgcggcctcgctgcgcaccgggctcgacgcggtcaatcaggtc
gaacgcatcaagccggacatcgccctgctcgacatcgagatgcccgagctcgacggcatc
gccgcgctgccgcaattgctggccaagaagcgcgacctgatcgtcatcatggcgtcgacc
ctgacgcgccgtaacgccgagatcagcttcaaggcgctgtcgctcggcgccgccgactac
attccgaagccggagacgacccgcgaatccgccggcgccgaggtgttcaggcacgacctg
ctgcagaagatccgccatctcggcggcaaggtgcggcgcagggtctcggcgccgagcgcc
agcgcgcccatggtcgcgcgcgttcgcgaggcggccgcagcaccggccgcgccgagcgtc
gccagtcaggcggcgctggtgaagcgtgcgttcggcccgacggcgccgcgcgtgctgctg
atcgggtcctcgaccggcgggccgcaggcgctgatgtcgctggtcgccgagatcggtccg
gtgatcgaccgctatccggtgctgatcacgcagcatatgccgccgaccttcacgacgatt
ctcgccgaacatctgatgcgcgccgcccggcggccggcgcacgagggcgtcgacggcgaa
ctgatcaagccgggccggatctatctggcccccggcggtcgccacatgcgggtgacccgc
cagggcggacagcccgcgatcgcgctcgacgacggcccggcggtgaatttctgcaagccc
gcggtcgacccgctgttcacctcggcgatcgacgtctggcagggcgggatcatggcggtg
gtgttgaccggaatggggtccgacggcatgcgcggcggcaaggacatcgtcgccgccggc
ggcagcgtgatcgcccaggacgaggccagcagcgtggtgtggggcatgcccggcgcggcg
gcgaatgccggcatctgcgccgcggtgttgccgctcaatcagatcgggccgaagctcgta
cgtttgttttcaggagatcggtcgtga

DBGET integrated database retrieval system