KEGG   Rhodopseudomonas palustris HaA2: RPB_3922Help
Entry
RPB_3922          CDS       T00321                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4474906..4475742
Genome map
AA seq 278 aa AA seqDB search
MGKGQAFGTGPVISHNDAVALMQPLTELVLRAGAAILATDRSDPVEHKPDGSPVTSADLA
ADRIIAEGLKRIAPDVPALSEERCDLGRPNTGSFFLVDPLDGTKEYVAGRDEFTVNLALV
TDGKPLLGIVGAPALGLVWRGLVGHGAERLAVDADGTGYDTTPIHTRPMPADGAPWVVAI
SRLHLDERTLAFIAERPGGVHARMGSALKFCRIADGAADIYPRLSPTCEWDIAAGAAVVI
AAGGELTDSSGRPLRFDEPRPNFIVPEFIAWGDARAAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagggccaggcgttcgggacaggaccggtgatttcgcacaacgacgccgtcgct
ttgatgcagccattgaccgagctggtgctgcgcgccggggccgcgatcctcgccaccgac
cgctccgacccggtcgagcacaagccggacggctcgccggtgacctccgccgacctcgcc
gccgaccgcatcatcgccgaggggctgaagcggatcgcgcccgacgtgccggcgctgtcg
gaagagcgctgcgacctcggccggccgaataccgggagcttcttcctggtcgatccgctc
gacggcaccaaggaatacgtcgccgggcgtgacgaattcaccgtcaatctggcgctggtg
accgacggcaagccgctgctcggcatcgtcggggcgccggcgctgggcctggtgtggcgc
ggcctggtcggccacggcgccgagcggctggcggtcgacgccgacggcaccggctacgac
acgacgccgatccacacccggccgatgccggccgacggagcgccgtgggtcgtggcgatc
agccggctgcatctcgacgaacgcactctggcgttcatcgccgagcggccaggcggcgtc
cacgcgcggatgggatcggcgctgaaattctgccggatcgccgacggcgcggccgacatc
tatccgcggctgtcgccgacctgcgaatgggacatcgccgccggcgccgccgtggtgatc
gccgccggcggcgaactgaccgacagcagcggccggccgctgcggttcgacgagccgcga
ccgaacttcatcgtgccggaattcatcgcctggggggatgcccgggcagcagcctga

DBGET integrated database retrieval system