KEGG   Rhodopseudomonas palustris HaA2: RPB_3987Help
Entry
RPB_3987          CDS       T00321                                 

Definition
(GenBank) Cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPB_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABD08680
JGI: RPB3987
UniProt: Q2ISY0
Position
4555272..4555691
Genome map
AA seq 139 aa AA seqDB search
MVRKFLAIVTITAAAGSLSTGIASAQDAAKGEAVFKQCMTCHRADKNMVGPALGGAVGRK
AGTAAGFTYSPLNHNSGEAGLVWTQENIVAYLPDPNAFLKKFLTDKGQADKAVGSTKMTF
KLANEQQRKDVAAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaaatttctcgcaattgtcaccatcaccgctgccgcaggatctctgtcgaca
ggtatcgcctcggcgcaggacgccgccaagggcgaagcggtgttcaagcagtgcatgacc
tgccatcgtgccgacaagaatatggtcggaccggccctcggcggcgccgtcggccgtaag
gcgggcacggctgccggcttcacctattcgccgctgaaccacaattccggcgaagccggt
ctggtctggacccaggaaaacatcgtggcctacctgccggatccgaatgccttcctgaag
aagttcctcaccgacaagggccaggccgacaaggccgtcggttcgaccaagatgaccttc
aaactggccaacgaacagcagcgcaaggatgttgcggcgtatctcgccacgctgaagtaa

DBGET integrated database retrieval system