KEGG   Rhodopseudomonas palustris HaA2: RPB_3987Help
Entry
RPB_3987          CDS       T00321                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPB_3987
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPB_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4555272..4555691
Genome map
AA seq 139 aa AA seqDB search
MVRKFLAIVTITAAAGSLSTGIASAQDAAKGEAVFKQCMTCHRADKNMVGPALGGAVGRK
AGTAAGFTYSPLNHNSGEAGLVWTQENIVAYLPDPNAFLKKFLTDKGQADKAVGSTKMTF
KLANEQQRKDVAAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaaatttctcgcaattgtcaccatcaccgctgccgcaggatctctgtcgaca
ggtatcgcctcggcgcaggacgccgccaagggcgaagcggtgttcaagcagtgcatgacc
tgccatcgtgccgacaagaatatggtcggaccggccctcggcggcgccgtcggccgtaag
gcgggcacggctgccggcttcacctattcgccgctgaaccacaattccggcgaagccggt
ctggtctggacccaggaaaacatcgtggcctacctgccggatccgaatgccttcctgaag
aagttcctcaccgacaagggccaggccgacaaggccgtcggttcgaccaagatgaccttc
aaactggccaacgaacagcagcgcaaggatgttgcggcgtatctcgccacgctgaagtaa

DBGET integrated database retrieval system