KEGG   Rhodopseudomonas palustris HaA2: RPB_4333Help
Entry
RPB_4333          CDS       T00321                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPB_4333
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RPB_4333
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPB_4333
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RPB_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4917658..4919295
Genome map
AA seq 545 aa AA seqDB search
MHDVPAATACRMVPSMSPHPPSSGLAFDRRMLLRGALGAGLAGALPAAAGAAERVAFKSD
PFTLGIASGDPAPDGFVLWTRLAPEPLEARGGMTPAPVEVTVEIADDAAMARVIRTVTAT
ARLELAHAVHAEIEGLAPGRDYFYRFRAGDAESPIGRARTLPAPGETPARLRFAAAGCQR
WEGGYYTAWRAIADDQLDFVFHYGDYIYEYAFAAHDRDGKPYPRTMPPDFPVCFTLTDYR
RRYALYKGDPDLQAAHASCPFLSSFDDHDVVNNWAADSDPKQTPPDAFLFRRAMALQAWY
EHMPVRRAQLPRGPDVRAYRGFRFGTLADIAVLDTRQYRSRQPCGDGFRAHCDEADAAGR
TMLGAAQEQWLAQRLKQSKATWQVLAQQVQFAPFDWRGFPFVKETDAPVLDLDTWSGASA
ARDRVTAMLAEANIANPVVLTGDLHRAMALDLRRDWRDPDSPRIGVEFLSTSISSPGDGP
ATAEKLAALYRNNPHLKFFSDRRGYTRHTVTPARWQADFRTVDSVATRGEPVTTAQTLMV
EAGRG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatgtaccggcggcaactgcttgccgaatggtaccgtcgatgtcccctcaccca
ccctcctccggcctcgccttcgaccgccgcatgctgctgcgcggcgcactcggggccggc
cttgccggcgcgctgccggccgccgccggcgcggcggagcgcgtcgccttcaagtccgac
ccgttcacgctcgggatcgcgtcgggtgatccggcgcccgacggcttcgtgctgtggacc
cgactggcgccggagccgctcgaggcacgtggcggcatgacgcccgcgccggtcgaggtc
accgtcgagatcgccgacgatgcggcgatggcgcgcgtgatacgcaccgtcacggccacc
gcccggctcgaactcgcgcacgcggtccatgccgaaatcgaaggcctcgccccggggcgc
gattacttctatcgcttccgcgccggcgacgccgaaagcccgatcggccgcgcccgcacc
ctgcccgcgcccggcgagacgccggcgcggctgcgtttcgctgcggccggctgccagcgc
tgggaaggcggttactacaccgcctggcgggcgatcgccgacgatcagctcgacttcgta
ttccactacggcgactacatctacgaatatgccttcgcggcgcacgacagggacggcaag
ccctacccgcgcacgatgccgccggactttccggtctgcttcacgttgaccgactatcgc
cgccgctacgcgctgtacaagggcgacccggacctgcaggcggcgcacgcctcctgtccg
ttcctgtcgagtttcgacgaccacgatgtcgtcaacaactgggccgccgacagcgacccg
aagcagaccccgcccgacgcctttctgttccgccgggcgatggcgctgcaggcctggtac
gagcatatgccggtgcgccgcgcgcagctcccgcgcggccccgacgtgcgcgcctatcgc
ggcttccgtttcggcacactcgccgacatcgccgtgctcgacacgaggcagtatcgctcg
cgccagccctgcggcgacggcttccgcgcgcattgcgacgaggccgatgcggccggtcgc
accatgctcggcgcagcgcaggagcagtggctggcgcagcggctgaagcagagcaaagcg
acctggcaggtactggcgcagcaagtgcagttcgcgccgttcgactggcgcggctttccg
ttcgtcaaggagaccgacgcgccggtactcgatctcgacacctggagcggcgccagcgcc
gcgcgcgaccgcgtgacggcgatgctcgccgaagcgaacatcgccaatccggtggtgctg
accggcgacctgcaccgggcgatggcgctggacttgcgccgcgactggcgcgatcccgac
tcgccgcgcatcggcgtcgaattcctgtcgacctcgatctcgtcgcccggtgacggcccg
gcgacggccgagaagctggcggcgctgtatcgcaacaacccgcatctgaaattcttcagc
gaccggcgcggctacacccgccacaccgtgacgccggcgcgctggcaggccgatttccgc
acggtggacagcgtcgcgacccgcggagagccggtcacaaccgcccaaaccctgatggtc
gaagccggccggggctga

DBGET integrated database retrieval system