KEGG   Rhodopseudomonas palustris HaA2: RPB_4384Help
Entry
RPB_4384          CDS       T00321                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RPB_4384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABD09071
JGI: RPB4384
UniProt: Q2IRT9
Position
complement(4968275..4969273)
Genome map
AA seq 332 aa AA seqDB search
MQSSRPARRPRSRLSGLCAALLCSVVDCAAAEMRELRTFAPLEAASSLDADKVALGRMLF
GDSILSRTRAIACTSCHDLARGGTVPLSRAIAEDGREHGFNAPTIFNVAANYLLGWRGKQ
TSLEAVSEKVLLDGRLMAADWELLTARLEQSRSYVSWFRRIYGRKADRASLLDALVTFQR
SLLTPNSRFDRYLRGDGSALTPGEREGLKLFMSYGCASCHQGVNLGGNMRQRFGIFPEPD
GPPESPSKAAPPDASEQNLFRVPSLRNVAVTAPYFHDGGVASLSEAVSIMGRRQLGQTLS
ASDTDAIVSFLKTLTGEYDGRELENPAPARVP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaagcagcaggccggcccgccgtccccgatccaggctgagcggtctgtgcgcggcg
ctgctgtgctcggtggtcgactgtgcggcggccgaaatgcgggagttgcgcacgttcgcc
ccgctcgaggcggcatcgtcgctcgacgccgacaaggtcgcgctcggccggatgttgttc
ggcgattcgattctgtcgaggacgcgggcgatcgcgtgcacatcctgccacgacctcgcc
cgtggcggaacggtgccgctgtcccgcgccatcgccgaagacggccgggagcacggcttc
aatgctccgacgatcttcaacgtcgcggcgaactacctgctgggctggcgcggcaagcag
acgtcgctcgaggccgtcagcgagaaagtgctgctcgacggccggttgatggccgccgat
tgggagctgctgaccgcaaggctcgaacagagccgatcgtatgtgtcgtggtttcgccgc
atctacgggcgcaaggccgatcgggcgagcctgctcgacgcgctggtgacgttccagcga
tcgctgctgacgccgaactcccgcttcgatcgctacctgcgcggcgacggctccgcactg
acgccgggcgaacgcgaggggctgaagctgttcatgagctacgggtgcgcgtcgtgtcac
cagggagtcaatctcggcggcaatatgcgtcagcgcttcggaatcttcccggagccggac
ggaccgccggaatccccttcgaaggctgcgccgccggacgcgtccgagcaaaatctgttt
cgggtgccgagcctgcgaaacgtcgcggtcaccgcaccgtacttccacgatggaggcgtc
gcgagtctgtcggaggcggtgtcgatcatggggcgacgccaactcggccagaccctctcc
gcctcggacacggacgccattgtgtccttcctgaaaacgctcaccggcgaatacgatggt
cgcgaactcgaaaatccggcgccggcacgtgttccgtga

DBGET integrated database retrieval system