KEGG   Rhodopseudomonas palustris HaA2: RPB_4534Help
Entry
RPB_4534          CDS       T00321                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rpb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5127290..5128234
Genome map
AA seq 314 aa AA seqDB search
MTLVSIPANPVPEGAVSGTIKTPDGAELRFARWPPPAGRKGTVCVFTGRTEQIEKYFETV
RDLQDRGFAVAMIDWRGQGHSARRLKDFRKGYVRNFSDFEIDVETFVREVVLPDCPPPHF
ALAHSMGGAVMLRIAYSGKRWFDRMVLSAPMIDLPGRATSLPVRLLLRAMRLAGQGGRYV
PGGNDVLANTEPFAGNPLTSDPVRYARNAAIIAEDPTLGLGSPTIAWADTAFRTMHGFRA
ADYPSRIRQPILMLAASHDTIVSTAAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRQQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgattcccgccaatccggttcccgagggcgccgtctccggcaccatc
aagacccccgacggcgccgagctgcggttcgcgcgatggccgccgccggccgggcgcaag
ggcacggtgtgcgtcttcaccggccgcaccgagcagatcgagaagtatttcgagacggtg
cgcgacctgcaggaccgcggcttcgcggtggcgatgatcgactggcgcggccagggccat
tcggcgcggcggctgaaggatttccgcaagggctatgtccgcaacttctcggacttcgag
atcgacgtcgagaccttcgtgcgcgaggtggtgctgccggactgtccgccgccgcatttc
gcgctggcgcattcgatgggcggcgcggtgatgctgcggatcgcctattccggcaagcgc
tggttcgaccgcatggtgctgtcggcgccgatgatcgacctgccgggccgcgccacctcg
ctgccggtgcggctgctgctgcgggcgatgcggctcgccggccagggcggccgctacgtg
cccggcggcaacgacgtgctcgccaacaccgagccgttcgccggcaaccctttgacctcc
gacccggtgcgctacgcccgcaatgccgcgatcatcgccgaggacccgacgctcggcctc
ggctcgccgaccatcgcctgggcggataccgcgttccgcaccatgcacggcttccgcgcg
gcggactatccgtcgcggatccggcagccgatcctgatgctcgccgccagccatgatacc
atcgtctcgactgccgcgatcgaggagttcgcctatcatctgcgcgcgggctcgcatctg
gtgatcgccggcgccaagcacgagatcctgcaggagcaggatcgctaccgccagcaattc
tgggcggcgttcgacgccttcgtgcccggcacgccactgttctga

DBGET integrated database retrieval system