KEGG   Rhodopseudomonas palustris HaA2: RPB_4535Help
Entry
RPB_4535          CDS       T00321                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00040  Pentose and glucuronate interconversions
rpb00052  Galactose metabolism
rpb00500  Starch and sucrose metabolism
rpb00520  Amino sugar and nucleotide sugar metabolism
rpb01100  Metabolic pathways
rpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPB_4535
   00052 Galactose metabolism
    RPB_4535
   00500 Starch and sucrose metabolism
    RPB_4535
   00520 Amino sugar and nucleotide sugar metabolism
    RPB_4535
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPB_4535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABD09218
JGI: RPB4535
UniProt: Q2IRE2
Position
5128382..5129257
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVVDEAKEAGIEHFIFVTGRNK
GMIEDHFDRQFELDMTLKGRNKTVEMELLARDQPEAGAMSFTRQQAPHGLGHAVWCARDI
VGNEPFAVVLPDELVLNSPGCLKQMIQAAEKLGDKANVIAVEEVPADMTHQYGICGVGKR
DGKIFEVDGMVEKPTKGTAPSNLSITGRYILQPEIFKILATQERGAGGEIQLTDAMIGLS
KTQTFYGVEFEGERHDCGSKAGFLRANIAFAMRRDDLRDGLVADMQRYLGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtcttcccggtcgccggcctcggcacccgcgtccttcccgcc
accaaggcgatgccgaaggagatgctgacgatcgtcgacaagccgctgatccagtacgtc
gtcgacgaggccaaggaagccggcatcgagcatttcatcttcgtcaccggccgcaacaag
ggcatgatcgaggaccatttcgaccgccagttcgaactggacatgacgctgaagggccgc
aacaagaccgtggaaatggagctgttggcgcgcgaccagccggaagccggcgcgatgagt
ttcacccgccagcaggcgccgcacggtctcggccacgcggtgtggtgcgcccgcgacatc
gtcggcaacgaaccgttcgcggtggtgctgccggacgagctggtgctgaactcgccgggc
tgcctcaagcagatgattcaggccgcggaaaagctgggcgacaaggccaacgtcatcgcg
gtcgaggaagtgccggccgacatgacccaccaatacggcatctgcggcgtcggcaagcgc
gacggcaagatcttcgaggtcgacggcatggtggagaagccgaccaagggcaccgcgccg
tccaacctgtcgatcaccggccgctacatcctgcagccggagatcttcaagatcctcgcc
acccaggagcgcggcgccggcggcgagatccagctcaccgacgcgatgatcgggctgtcg
aagacgcagacattctacggcgtcgaattcgagggcgagcgccacgattgcggctcgaag
gccggcttcctgcgcgccaacatcgccttcgcgatgcggcgcgacgatctgcgcgacggc
ctcgtcgccgacatgcagcgctatctcgggacgtga

DBGET integrated database retrieval system