KEGG   Rhodopseudomonas palustris HaA2: RPB_4535Help
Entry
RPB_4535          CDS       T00321                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPB_4535
   00052 Galactose metabolism
    RPB_4535
   00500 Starch and sucrose metabolism
    RPB_4535
   00520 Amino sugar and nucleotide sugar metabolism
    RPB_4535
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPB_4535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5128382..5129257
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVVDEAKEAGIEHFIFVTGRNK
GMIEDHFDRQFELDMTLKGRNKTVEMELLARDQPEAGAMSFTRQQAPHGLGHAVWCARDI
VGNEPFAVVLPDELVLNSPGCLKQMIQAAEKLGDKANVIAVEEVPADMTHQYGICGVGKR
DGKIFEVDGMVEKPTKGTAPSNLSITGRYILQPEIFKILATQERGAGGEIQLTDAMIGLS
KTQTFYGVEFEGERHDCGSKAGFLRANIAFAMRRDDLRDGLVADMQRYLGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtcttcccggtcgccggcctcggcacccgcgtccttcccgcc
accaaggcgatgccgaaggagatgctgacgatcgtcgacaagccgctgatccagtacgtc
gtcgacgaggccaaggaagccggcatcgagcatttcatcttcgtcaccggccgcaacaag
ggcatgatcgaggaccatttcgaccgccagttcgaactggacatgacgctgaagggccgc
aacaagaccgtggaaatggagctgttggcgcgcgaccagccggaagccggcgcgatgagt
ttcacccgccagcaggcgccgcacggtctcggccacgcggtgtggtgcgcccgcgacatc
gtcggcaacgaaccgttcgcggtggtgctgccggacgagctggtgctgaactcgccgggc
tgcctcaagcagatgattcaggccgcggaaaagctgggcgacaaggccaacgtcatcgcg
gtcgaggaagtgccggccgacatgacccaccaatacggcatctgcggcgtcggcaagcgc
gacggcaagatcttcgaggtcgacggcatggtggagaagccgaccaagggcaccgcgccg
tccaacctgtcgatcaccggccgctacatcctgcagccggagatcttcaagatcctcgcc
acccaggagcgcggcgccggcggcgagatccagctcaccgacgcgatgatcgggctgtcg
aagacgcagacattctacggcgtcgaattcgagggcgagcgccacgattgcggctcgaag
gccggcttcctgcgcgccaacatcgccttcgcgatgcggcgcgacgatctgcgcgacggc
ctcgtcgccgacatgcagcgctatctcgggacgtga

DBGET integrated database retrieval system