KEGG   Rhodopseudomonas palustris HaA2: RPB_4578Help
Entry
RPB_4578          CDS       T00321                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPB_4578
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_4578
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPB_4578
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPB_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5174593..5176011)
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGEAPQLGFCDVMLTGLARDGGLYIPDVWPQLSPDAIAALFGRPYWEVAVEVI
RPFVAGEISDAELGRMANEAYATFRHPAVVPLRQSGSSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRRQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SGAPNVHALAIEGHFDDCQAIVKGLFNHHAFRDKVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRVVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANTNDILARTLKTGIYEVRE
VHSTTSPSMDIQVSSNFERLLFEATGRDAAQVRALMGSLHQSGRFVLPDAVLAAIREEFD
AGRADETETEAAIRTAWREAGDLVDPHTAVALAVADRDTTDPTVPNIVLSTAHAAKFPDA
VEAACGMRPELPAWLGGLMSGTETMKIMPRDQAAIERHILSVSRAAKQGAVG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctatgtttccacccggggcgaagccccgcagctcggcttttgcgatgtgatg
ctgaccgggctcgcccgtgacggcgggctctacatccctgacgtctggccgcagctttcg
cccgacgccatcgccgctttgttcggccggccgtattgggaggtcgccgtcgaggtgatc
cggccgttcgtcgccggcgagatttccgatgccgagctcggccggatggccaatgaagcc
tacgccaccttccggcatcccgccgtggtgccgctgcgccagagcgggtcgagccagttc
gtgctcgagctgtttcacggtccgacgctggcgttcaaggacgtcgcgatgcagttgctg
tcgcggctgatggatcacgtgctggagaagcgccggcagcgcaccaccatcgtggtcgcg
acctccggcgacaccggcggcgccgcggtcgatgccttcgccaatttgaacaatgtcgat
ctggtggtgctgtttccgcatggccggatctccgacgtgcagcggatgatgatgacgacg
tcgggcgcgccgaatgtgcatgcgctggcgatcgagggccatttcgacgattgccaggcg
atcgtgaaggggctgttcaaccaccacgccttccgcgacaaggtggcgctgtcgggcgtc
aattcgatcaactgggcgcggatcgtcgcccaggtggtgtactacttcaccagcgcggtg
gcgctcggcgcgcccaaccgcgtcgtcgatttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctatgtcgccaagaaaatgggcctgccggtgcggcggctgaagatcgcc
gccaacaccaacgacattctggcgcggacgctgaagaccgggatctacgaggtccgcgag
gtccattccacgacctcgccgtcgatggacattcaggtgtcgtcgaatttcgaacggttg
ctgttcgaggcgaccggccgcgacgccgcgcaggtgcgggcgctgatggggtcgctgcac
cagtccggccggttcgtgctgccggatgccgtgctggcggcgatccgcgaggaattcgac
gccggccgtgccgacgagaccgagaccgaggccgcgatccgtactgcttggcgcgaggcc
ggcgatctggtcgatccgcacaccgcggtggcgctggcggtcgccgatcgcgacaccacg
gacccgaccgtgcccaatatcgttctgtccacggcgcacgccgccaaattccccgacgcg
gtcgaggccgcctgcggaatgcggccggaactgccggcctggctcggcgggctgatgagc
ggcaccgaaacgatgaagatcatgccgcgcgaccaggcggcgatcgaacgccacatcctg
tctgtcagtcgggcggcgaaacaaggagcagtcggatga

DBGET integrated database retrieval system