KEGG   Rhodopseudomonas palustris HaA2: RPB_4578Help
Entry
RPB_4578          CDS       T00321                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00260  Glycine, serine and threonine metabolism
rpb00750  Vitamin B6 metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01230  Biosynthesis of amino acids
Module
rpb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_4578
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPB_4578
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPB_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP GAF_2
Motif
Other DBs
NCBI-ProteinID: ABD09261
JGI: RPB4578
UniProt: Q2IR99
Position
complement(5174593..5176011)
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGEAPQLGFCDVMLTGLARDGGLYIPDVWPQLSPDAIAALFGRPYWEVAVEVI
RPFVAGEISDAELGRMANEAYATFRHPAVVPLRQSGSSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRRQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SGAPNVHALAIEGHFDDCQAIVKGLFNHHAFRDKVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRVVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANTNDILARTLKTGIYEVRE
VHSTTSPSMDIQVSSNFERLLFEATGRDAAQVRALMGSLHQSGRFVLPDAVLAAIREEFD
AGRADETETEAAIRTAWREAGDLVDPHTAVALAVADRDTTDPTVPNIVLSTAHAAKFPDA
VEAACGMRPELPAWLGGLMSGTETMKIMPRDQAAIERHILSVSRAAKQGAVG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctatgtttccacccggggcgaagccccgcagctcggcttttgcgatgtgatg
ctgaccgggctcgcccgtgacggcgggctctacatccctgacgtctggccgcagctttcg
cccgacgccatcgccgctttgttcggccggccgtattgggaggtcgccgtcgaggtgatc
cggccgttcgtcgccggcgagatttccgatgccgagctcggccggatggccaatgaagcc
tacgccaccttccggcatcccgccgtggtgccgctgcgccagagcgggtcgagccagttc
gtgctcgagctgtttcacggtccgacgctggcgttcaaggacgtcgcgatgcagttgctg
tcgcggctgatggatcacgtgctggagaagcgccggcagcgcaccaccatcgtggtcgcg
acctccggcgacaccggcggcgccgcggtcgatgccttcgccaatttgaacaatgtcgat
ctggtggtgctgtttccgcatggccggatctccgacgtgcagcggatgatgatgacgacg
tcgggcgcgccgaatgtgcatgcgctggcgatcgagggccatttcgacgattgccaggcg
atcgtgaaggggctgttcaaccaccacgccttccgcgacaaggtggcgctgtcgggcgtc
aattcgatcaactgggcgcggatcgtcgcccaggtggtgtactacttcaccagcgcggtg
gcgctcggcgcgcccaaccgcgtcgtcgatttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctatgtcgccaagaaaatgggcctgccggtgcggcggctgaagatcgcc
gccaacaccaacgacattctggcgcggacgctgaagaccgggatctacgaggtccgcgag
gtccattccacgacctcgccgtcgatggacattcaggtgtcgtcgaatttcgaacggttg
ctgttcgaggcgaccggccgcgacgccgcgcaggtgcgggcgctgatggggtcgctgcac
cagtccggccggttcgtgctgccggatgccgtgctggcggcgatccgcgaggaattcgac
gccggccgtgccgacgagaccgagaccgaggccgcgatccgtactgcttggcgcgaggcc
ggcgatctggtcgatccgcacaccgcggtggcgctggcggtcgccgatcgcgacaccacg
gacccgaccgtgcccaatatcgttctgtccacggcgcacgccgccaaattccccgacgcg
gtcgaggccgcctgcggaatgcggccggaactgccggcctggctcggcgggctgatgagc
ggcaccgaaacgatgaagatcatgccgcgcgaccaggcggcgatcgaacgccacatcctg
tctgtcagtcgggcggcgaaacaaggagcagtcggatga

DBGET integrated database retrieval system