KEGG   Rhodopseudomonas palustris HaA2: RPB_4604Help
Entry
RPB_4604          CDS       T00321                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00071  Fatty acid degradation
rpb00280  Valine, leucine and isoleucine degradation
rpb00281  Geraniol degradation
rpb00310  Lysine degradation
rpb00362  Benzoate degradation
rpb00380  Tryptophan metabolism
rpb00410  beta-Alanine metabolism
rpb00640  Propanoate metabolism
rpb00650  Butanoate metabolism
rpb00903  Limonene and pinene degradation
rpb00930  Caprolactam degradation
rpb01040  Biosynthesis of unsaturated fatty acids
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
rpb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPB_4604
   00650 Butanoate metabolism
    RPB_4604
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_4604
   01040 Biosynthesis of unsaturated fatty acids
    RPB_4604
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPB_4604
   00310 Lysine degradation
    RPB_4604
   00380 Tryptophan metabolism
    RPB_4604
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPB_4604
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPB_4604
   00281 Geraniol degradation
    RPB_4604
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPB_4604
   00930 Caprolactam degradation
    RPB_4604
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RPB_4604
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPB_4604
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RPB_4604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH FAD_binding_3 UDPG_MGDP_dh_N NAD_binding_2 DAO F420_oxidored NAD_binding_8 GIDA ApbA Pyr_redox_2 2-Hacid_dh_C Rib_5-P_isom_A Sacchrp_dh_NADP NAD_Gly3P_dh_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABD09287
JGI: RPB4604
UniProt: Q2IR73
Position
complement(5197662..5199878)
Genome map
AA seq 738 aa AA seqDB search
MTFKIFKLETDADGIALVTWDLPGKSMNVLDAATIEELGAIVEQTTKDAAVKGVVITSAK
EAFCAGADLSMLETMNRQFAQIRKDKGEEAAQQMLFDESRKLSQILRSIETSGKPWVAAI
NGLALGGGFEVTLACHYRVAADNPKSRLGLPEIKVGLFPGGGGTQRIPRIVSPQDAMTIL
LKGDQIKLDKAKAWKLVDAVVPAADLIQTAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLLVPMDTALRIESRYFAKVLQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIDVVLIDRDQ
ESADKGKAHCKSVIDGLIAKGRAKPADAEALMSRITATPDYNAISDCDLVIEAVFEDRKI
KAETYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFVGIHFFSPVEKMMLVEIIVG
KNTGDVALATALDYTRQINKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGIPAPMIETA
AKMAGMPVGPLSLADEVALDLVLKIMKATEADLGEQAVDQQQKKLMVEMVEKQGRFGRKN
AKGFYDYPEKGKGQKALWAGIGALQPKHVDPDTVDVEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEGKYGSRFTPPKLLEDMA
KTGETFYQRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaagatcttcaagctcgaaaccgacgccgacggcattgcgctggtgacctgg
gacctgcccggcaagtcgatgaacgtgctggacgccgcgaccatcgaggaactcggcgcg
atcgtcgagcagaccaccaaggacgccgcggtcaagggcgtggtgatcacctccgccaag
gaggcgttctgcgccggcgccgacctgtcgatgctggaaaccatgaaccggcagttcgcc
cagatccgcaaggacaagggcgaggaggccgcgcagcagatgctgttcgacgagagccgc
aagctgtcgcagatcctgcgcagcatcgagaccagcggcaagccgtgggtcgcggcgatc
aacggcctcgcgctcggcggcggcttcgaagtgacgctggcctgccactatcgcgtcgcc
gccgacaatccgaagtcgcggctcggcctgcccgagatcaaggtcggcctgttccccggc
ggcggcggcacccagcggattccgcgtatcgtctcgccgcaggacgcgatgacgatcctg
ctcaagggcgaccagatcaagctcgacaaggccaaggcctggaagctggtcgacgccgtg
gtgccggccgcggatttgatccagaccgcgaaggactggatcaagggcggcggcaaggct
gtggcgccgtgggacgagaagggcttcaagctgcccggcggtccggtgttctccaagcag
ggcatgatgatgttcccggccggcaacgcgatctatcgccgcgagacctacgacaactac
ccggccgcgcgcgcgatcatgagctgcgtctacgagggcctgctggtgccgatggatacg
gcgctgcggatcgagtcgcgctacttcgccaaggtgctgcagaccaaggaagccgcggcg
atgatccgcagcctgttcttgtcgatgcaggagctgaacaagggcgcgcgccgcccgcag
ggcgtgccgccgaccaaggtcaagaagctggccatcatcggcgccggcttcatgggcgcc
agcgtaggctacgtctcggccaaggccggcatcgacgtggtgctgatcgatcgcgatcag
gagagcgccgacaagggcaaggcgcactgcaagagcgtgatcgacggcctgattgccaag
ggccgcgccaagccggccgacgccgaagcgctgatgtcgcgcatcacggccacgccggac
tacaacgcgatctcggattgcgacctggtgatcgaggcggtgttcgaggatcgtaagatc
aaggccgagacctacgccaaggcgcaaccgctcttgaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcaattcgctggccgaggagttcaaggaccagtcgaaattc
gtcggcatccacttcttctcgccggtcgagaagatgatgctggtcgaaatcatcgtcggc
aagaacaccggcgacgtcgcgctcgcgaccgcgctcgactacacccgtcagatcaacaag
accccgatcgtggtcaacgattcgcgcggcttcttcgccaaccgctgcgtgctgcgcttc
accgccgaaggcctcgagatgctgatggaaggcatcccggcgccgatgatcgagaccgcg
gcgaagatggccggcatgccggtcgggccgctgtcgctcgccgacgaggtcgcgctcgat
ctggtgctgaagatcatgaaggccaccgaggccgatctcggcgaacaggcggtcgatcag
cagcagaagaagctgatggtcgagatggtggagaagcagggccggttcggccgcaagaac
gccaagggcttctacgactatccggagaagggcaagggccagaaggcgctgtgggccggc
atcggcgcactgcagcccaagcacgtcgatccggatacggtcgacgtcgaggaactgaag
cagcgcttcttggtggtgcaggcggtcgaagccgcgcgcaccgtcgaggatcacgtcatc
accgatccgcgcgaggccgatgtcggctccatcctcggattcggcttcgcgccgttcacc
ggcggcacgctgagctacatcgacttcatgggcaccaaggagttcgtggcactgtgccac
aagctcgagggcaaatacggctcgcgcttcacgccgccgaagctgctcgaagacatggcc
aagaccggcgaaaccttctaccagcgcttcgccccgaagaagcaggccgcggcgtaa

DBGET integrated database retrieval system