KEGG   Rhodopseudomonas palustris HaA2: RPB_4698Help
Entry
RPB_4698          CDS       T00321                                 

Definition
5'-methylthioadenosine phosphorylase (EC:2.4.2.28)
Orthology
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RPB_4698
Enzymes [BR:rpb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     RPB_4698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5316808..5317713)
Genome map
AA seq 301 aa AA seqDB search
MRSERRGRQGMTRAVLGIIGGSGIYDLPGLEDVREEAIASPWGEPSSAVRRGNIAGLPIV
FLPRHDKGHRLSPSDINYRANIDVLKRAGVTDLISLSACGSFKEELPPGTFVLVDQFVDR
TYKRESSFFGRGCVAHVSMAHPVSPRLRIHLAAAAEAEGIAFARGGTYLCMEGPQFSSYA
ESVTYKQLGYSVIGMTNMPEAKLAREAEICYATVAMVTDFDCWHPDHDAVTVQDIIRVLT
TNAEKAKSLVARLAQDFPREHEDCPIGSDRALDTALITQPDARDPELLKKLDAVAGRILK
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggaacgacgcgggagacagggcatgaccagggcggtactcggcatcatcggc
ggatccggcatctatgatttgccggggctggaggacgtccgcgaggaggcgatcgcgagc
ccgtggggcgagccgtcctcggcggtgcggcgcggcaacatcgccggcctgccgatcgtg
ttcctgccgcgccacgacaagggccaccggctgtcgccctccgacatcaactaccgcgcc
aatatcgacgtgctgaaacgcgccggtgtcaccgacctgatctcgctgtcggcctgcggc
tcgttcaaggaagagctgccgcccggcaccttcgtgctggtcgaccagttcgtcgatcgc
acctacaagcgcgagagttcgttcttcggccgtggctgcgtcgcccacgtctcgatggcg
catccggtgagcccgcggctgcgcatccatctcgccgccgccgccgaggccgaaggcatc
gcgttcgcgcgcggcggcacctacctctgcatggaaggcccgcaattctccagctacgcc
gagagcgtcacctacaagcagctcggctattcggtgatcggcatgaccaacatgccggag
gccaagctcgcccgcgaggccgagatctgctacgccaccgtggcgatggtgaccgatttc
gactgctggcaccccgaccacgacgccgtcacggtgcaggacatcatccgggtgctgacc
accaatgccgaaaaggccaagagcctggtggcgcggctggcgcaggacttcccgcgcgag
cacgaagactgcccgatcggctccgaccgcgcgctggacaccgctctgatcacccagccc
gacgcgcgcgatccggaactgctgaagaagctggatgcggtggcggggcggattttgaag
ggttag

DBGET integrated database retrieval system