KEGG   Rhodopseudomonas palustris BisB18: RPC_0030Help
Entry
RPC_0030          CDS       T00336                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34627..36375)
Genome map
AA seq 582 aa AA seqDB search
MIKPLAATFALLMSGTAAFAQTIYPIDRADILAGSRFDFKVEFPGVVDPAKLKVTVNGAD
TTGAFGRAAEFIVREDGKEQSALLLREVALTKPGRYVIEASDGSLSRSVAWNVYDTGPRK
AKNVILFIGDGLSPAHRIAARLLSKGIVEGKSLGKLAIDDMPQMALVATAGSDSIITDSA
NAASAYATGHKAAVNAMGVYADRTASPFDDPQVETIGSLAKRRLGLAVGIVTNTEIEDAT
PAAMLAHTRRRAAYDEIVAQYFAAKPDVLMGGGAANFLPKGAPGSKRRDDADYVAKFRDA
GYTVATNAAELGAAKPDTQKLLGLFAPGNMDGVLDRKLLKGGGVKKNPNQPDLTEQLGAA
LSVLSKNPNGFFLMVESGLIDKYAHALDMERAVYDTIMLDNAVRQARDWSAARGDDTLIL
VLADHNHPNALVGTINDDMTTVPNVPLRERVGVYEKAGFPDYPAPDKDGYPSRVDVNRRL
AIFSASLPDHYETYRPKLDNPNEPTEKAEAGTFKANEKYKDVPGAVLRFGNLPAMMNASV
HSGEDVILTAVGPGSDRVHGSMDNTEVFRVIADALGLAPAKD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaccgcttgccgccacctttgcccttctgatgtcgggaacggccgcgtttgcg
cagaccatctatccgatcgatcgcgcggacatcctggcgggcagccggttcgacttcaag
gtcgagtttcccggcgtcgtcgatcccgccaagctgaaggtcaccgtcaacggcgcggac
accaccggcgccttcggccgcgccgccgagttcatcgtccgcgaggacggcaaggagcaa
tcggcgctgctgttgcgcgaggtggcgctgacgaagcccggccgctacgtgatcgaggcc
agcgacggcagcttgagccgcagcgtcgcctggaatgtctacgacaccgggccgcgcaag
gccaagaacgtcatcctgttcatcggcgacgggctgtcgccagcgcaccgcatcgcggcg
cggctattatccaagggcatcgtcgagggcaagagcctcggcaagcttgcgatcgacgac
atgccgcagatggcgctggtggcgacagcgggctcggattcgatcatcaccgattcggcc
aatgccgcttcggcctacgccaccggccacaaggccgcggtcaatgccatgggcgtttac
gccgaccgcaccgcgagcccgttcgacgatccgcaggtcgagaccatcggcagcttggcc
aagcgcaggctcggcctggcggtcggcatcgtcaccaataccgagatcgaggacgccacc
ccggcggcgatgctggcgcataccaggcggcgcgccgcctatgacgaaatcgtcgcgcaa
tatttcgccgccaagcccgacgtgctgatgggcggcggcgctgcgaatttcctgccgaaa
ggcgcgccgggctcgaagcgccgcgacgacgccgactacgtcgcgaaattccgcgacgcc
ggctacacggtggcgaccaatgcggccgaactcggcgccgccaaacccgacacccagaag
ctgctcgggctgttcgcgcccggcaatatggacggtgtgctcgaccgcaaactcctcaag
ggcggcggggtgaagaagaatcccaaccagccggatctcaccgagcagctcggcgcggcg
ctttcggtgctgtcgaaaaatcccaacggcttcttcctgatggtggaatccgggctgatc
gacaaatacgcccacgcgctcgacatggaacgggcggtgtacgacactatcatgctcgat
aacgcggtgcgccaggcgcgcgactggtcggcggcgcgcggcgacgacacgctgatcctg
gtgctggccgatcacaaccatccgaacgcgctggtcggcaccatcaacgacgatatgacc
acggtgccgaacgtgccgctacgtgagcgcgtcggggtctatgagaaagccggcttcccg
gactatccggcgcccgacaaggacggctatccgtcgcgggtcgacgtcaaccgccggctg
gcgatcttttcggcgagcctgcctgaccactacgaaacctatcggccgaagctcgacaat
ccgaacgagccgaccgagaaggccgaggctggcaccttcaaggccaacgagaaatacaag
gatgtgcccggcgcggtgctgcggttcggcaatctgccggcgatgatgaacgccagcgtg
cattccggcgaagacgtgatcctgaccgcggtcggccccggcagcgaccgcgtgcatggt
tcgatggacaataccgaggtgttccgggtgatcgccgacgcgctcggtttggcgccggcg
aaggattaa

DBGET integrated database retrieval system