KEGG   Rhodopseudomonas palustris BisB18: RPC_0047Help
Entry
RPC_0047          CDS       T00336                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_0047
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RPC_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54230..54976
Genome map
AA seq 248 aa AA seqDB search
MALLVTRPQPDNETTAVALRTKGYEVLLAPMLRFEAVAVKDDPEARYGAVIVTSANALRA
VAGQTGIARLLDLPLFAVGARTAQSARDAGFRNVIVADGDASALRDKIVAAARAKQLQKA
DTLLYLSGAEVARDLAGELRALGFNIATQTAYKMIPVRDLPDEVCDAFAANRIEAVLHYS
GRSARSFLEAARSAGIEISALAVPQCCLSAAVAGVVREAGATRVMEARRPDEAALFDVLD
RALSPLAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgctcgtcacccgcccgcaacccgacaacgagaccaccgctgtggcgttgcgg
accaagggatacgaggtgctgctggcgccgatgctgcggttcgaagcggtcgcggtgaag
gacgatcccgaggcgcgctacggcgcggtgatcgtcaccagcgccaatgcgctgcgcgcc
gtcgccggccagaccggcattgcccggctgctcgatctgccgttgttcgcggttggcgcg
cgcaccgcgcaaagcgcgcgcgatgcaggatttcgcaacgtcatcgtcgccgatggcgac
gccagcgcgctgcgcgacaagatcgtcgccgccgcccgcgccaaacagctgcaaaaggcc
gacaccctattgtatctgtccggagccgaggtcgcccgcgatctcgcaggtgagctgcgc
gcgctggggttcaatatcgccacacagaccgcttataagatgataccggtacgcgatctg
cccgacgaggtctgcgacgcctttgccgcaaatcgcatcgaggccgtgctgcattattcg
ggacgcagtgcgcgctcgtttctggaagcggcgcggagcgcggggatcgagatttcggcg
ctggcggtgccgcaatgctgcctgtcggcggcggtcgccggggtggtgcgcgaagccggg
gcgacccgggtgatggaggcgcgcaggccggatgaggccgcgttgttcgacgtgctagat
cgtgcgctgagcccgctggcacgctaa

DBGET integrated database retrieval system