KEGG   Rhodopseudomonas palustris BisB18: RPC_0071Help
Entry
RPC_0071          CDS       T00336                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPC_0071
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPC_0071
   00650 Butanoate metabolism
    RPC_0071
  Energy metabolism
   00190 Oxidative phosphorylation
    RPC_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(80790..81212)
Genome map
AA seq 140 aa AA seqDB search
MSVEESHGPTPRRAKSLRTPLGKVRKFGPAGSGTSDFWQQRITGVAMTLLILPVVVVIMM
LLGRNQAGAAQIIGSPLIALTLILFIISSAVHMKIGMQVVIEDYVQNEKLKLVTIMANNF
FSIAVALAAIFAIFKLSSGV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgaggaatcgcacggtccgacgccgcgccgcgccaagagcctgcggacgccg
ctcggcaaagtccgcaaattcggacccgccggatccggcacgtccgatttctggcagcaa
cgcatcaccggggtggcgatgacgctgttgatcctgccggtggtggtggtgatcatgatg
ctgctcggccgcaaccaggccggcgccgcgcagatcatcggctcgcccttgatcgcgctg
acgctgatcctgttcatcatctccagcgccgtgcacatgaagatcggcatgcaggtggtg
atcgaggactatgtgcagaacgaaaagctgaagctggtcaccatcatggccaacaatttc
ttctcgatcgccgtggcgctggccgcgatctttgcgattttcaaactatcatccggagtg
taa

DBGET integrated database retrieval system