KEGG   Rhodopseudomonas palustris BisB18: RPC_0158Help
Entry
RPC_0158          CDS       T00336                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00330  Arginine and proline metabolism
rpc00332  Carbapenem biosynthesis
rpc01100  Metabolic pathways
rpc01130  Biosynthesis of antibiotics
rpc01230  Biosynthesis of amino acids
Module
rpc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RPC_0158
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RPC_0158
Enzymes [BR:rpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RPC_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABD85733
UniProt: Q21D03
Position
174957..176087
Genome map
AA seq 376 aa AA seqDB search
MHRPELKNFRRIVVKVGSSLLIDSEAGEVKAAWLAALAADIAELHLHGRDVLIVSSGSIA
LGRSRLKLARGPLKLEESQAAAAVGQIALARIWSEVLGDHGIGAGQILVTLQDTEERRRY
LNARSTIGKLLEWRAVPVINENDTVATAEIRYGDNDRLAARVATMSSADLLILLSDIDGL
YDAPPGANPDAKLIPVVEQVTAEIEAMAGGAESELSRGGMRTKIEAAKIATTAGTHMLIA
SGKIDHPLRAIANGGACTWFLTPANPVTARKRWIAGSLEPKGTLTIDAGAVTALRAGKSL
LPAGVIRVDGHFARGDAVVVRGPDTDEIGRGLVAYDADDADRIKGHSSPDVMSILGITGR
AEMIHRDDLVMGAVPG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcccgaactgaagaatttccgccgcatcgtcgtcaaggtcggctcctcgctg
ctgatcgattccgaggccggcgaggttaaggcggcctggctcgccgcccttgccgccgat
atcgccgaattgcatctgcacggccgcgacgtgctgatcgtctcctctggctcgatcgcg
ctcggccgcagccggctgaagctggcgcgcggcccgttgaagctggaggaaagccaggcc
gccgccgccgtcgggcagatcgcgctggcgcggatctggtccgaggtgctgggcgatcac
ggcatcggcgccggacagattctggtgacgctgcaggacaccgaggagcgccgccgctat
ctcaacgcccgctccaccatcggcaagctgttggaatggcgcgcggtgccggtgatcaac
gagaacgacaccgtcgccactgcggaaatccgctacggcgacaatgaccggctcgccgcc
cgcgtcgccaccatgagcagcgccgatctgttgatcctgttgtccgacatcgacgggctg
tatgacgcgccgcccggcgccaatcccgacgccaagctgatcccggtggtggagcaggtc
accgccgagatcgaggcgatggccggcggtgccgaatccgaattgtcgcgcggcggcatg
cgcaccaagatcgaagccgccaagatcgccaccaccgccggcacccatatgctgatcgcg
tcgggcaagatcgaccacccgctgcgcgccatcgccaatggtggcgcctgcacctggttt
ctcaccccagccaatcccgtcaccgcgcgaaaacgctggatcgcgggctcgttggagccg
aagggcacgctgaccatcgacgccggcgcggtcaccgcgctgcgcgccggcaagagcctg
ctgccggccggcgtgatccgggtcgacggccatttcgcccgcggcgacgccgtggtggtg
cgcgggcccgacaccgacgagatcggtcgcggtctggtcgcctacgatgccgacgacgcc
gaccgcatcaagggccactcctcgcccgacgtgatgagcatcctcggcatcaccggccgc
gccgagatgatccaccgcgacgacctggtgatgggggcggtgccgggctaa

DBGET integrated database retrieval system