KEGG   Rhodopseudomonas palustris BisB18: RPC_0171Help
Entry
RPC_0171          CDS       T00336                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_0171
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RPC_0171
Exosome [BR:rpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPC_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(186986..187960)
Genome map
AA seq 324 aa AA seqDB search
MVAAFPIVRPRRLRRSEALRQLVRETRVCAHDLIYPIFVEEQIDDAVPIATMPGVLRIPE
RKLAAEIERIARDGVKAVLLFGISHHKDAIGSDSWNPDGLMARMVRIAKAAAPELVVITD
NCFCEYTLHGHCGSLRGDSVDNDATLLNLGRQAVVAIEAGADMVAPSAMMDGQIQAMRTA
LDEAGHCEAPILAYSSKFASALYGPFRVAAGSELEGDRRSYQMDPMNGREALRESALDEA
EGADLLMVKPALAYLDVLAALRARTELPLVAYQVGGEYAMIKFAAMAGALDEAATVRETL
GAIKRAGADLIISYFARDIARDGW
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagccttcccgattgtccgtccgcggcgactgcgccgcagcgaagcgctgcgc
caattggtgcgcgaaacccgggtctgcgcccacgacctgatctatccgatcttcgtcgag
gaacagatcgacgacgcggtgccgatcgccacgatgcccggcgtgcttcgcattcccgag
cgaaaactcgccgccgagatcgagcggatcgcgcgggacggcgtcaaggcggtgttgctg
ttcggcatttcgcatcataaggacgcgatcggcagcgatagctggaatccggacgggctg
atggcgcggatggtgcggatcgccaaggctgcggcgcccgagctggtggtgatcaccgac
aactgcttctgcgaatacaccctgcacggccattgcggctcactgcggggcgacagcgtc
gataacgacgccacgctactcaatctcggtcgccaggcggtggtggcgatcgaggccggc
gccgacatggtggcgccgtcggcgatgatggacggtcagatccaggcgatgcgcacggcg
ctcgacgaagccgggcattgcgaggcgccgatcctggcctattcgtcgaaattcgcctcg
gcgctgtatgggccgttccgggtggccgccggctcggagctcgagggcgatcggcgaagt
tatcagatggacccgatgaacggccgcgaagcgctgcgggaatccgcgctcgacgaggcg
gagggcgccgatctgttgatggtgaagccggcgctggcctatctcgacgtgctggcggcg
ctgcgcgcgcgcaccgagctgccgctggtcgcctatcaggtcggcggcgaatacgcgatg
atcaaattcgcagcaatggccggcgcgctcgacgaagccgcgaccgtgcgcgagacgctc
ggcgcgatcaaacgcgccggcgccgatctgatcatcagctatttcgcccgcgacatcgcg
cgcgacggctggtga

DBGET integrated database retrieval system