KEGG   Rhodopseudomonas palustris BisB18: RPC_0190Help
Entry
RPC_0190          CDS       T00336                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPC_0190
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPC_0190
  Amino acid metabolism
   00310 Lysine degradation
    RPC_0190
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPC_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204840..206144)
Genome map
AA seq 434 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVAVGALLGQITDGAAKAAPKDAAKASGVAPETTTGRPDLKTDGTKPINAGPEEPR
LRPEAKAEAKSLPADTPQAPSVRRLSAENGVDAATVPGSGKDGRVTKGDMLAAIEKAASA
PTPVDQPAAAVQVRSPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMS
HIMALRAQYKEVFEKRHHSKLGFMGFFVRACVQALKDIPAANAEIDGTDLIYKNYYHIGV
AVGTDKGLVVPVVRDCDHKSIAQIEKSIADFGKRARDGQLKIDEMQGGTFTITNGGIYGS
LMSTPILNAPQSGILGMHKIQERPVAIAGKVEIRPMMYLALSYDHRVIDGKDAVTFLVRV
KESLEDPTRLVLDL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccaacgctcggcgaatcggtgaccgaggcgaccatcggccgc
tggttcaagaaggccggcgacgccgtcgcggtcgacgagccgttggtcgaactggaaacc
gacaaggtcaccatcgaggtgccggcgccctccgccggaacgctcggcgagatcgtcgcc
aaggacggcgagaccgtcgcggtcggcgccttgctcggccagatcaccgacggcgccgcg
aaggccgcgccgaaggacgccgccaaggcttccggcgtcgcgccggagaccaccaccggc
cgccccgacctgaagaccgatggcaccaagccgatcaacgccggcccggaagagccgcgg
ctgcggcccgaggccaaggctgaggccaaatcgctgccggctgacacgccgcaggcgccg
tcggtgcgcaggctttcggccgagaacggcgtcgacgccgctaccgtgccgggctccggc
aaggacggccgcgtcaccaagggcgacatgctggcggcgatcgagaaggcggcctccgcg
ccgaccccggtcgatcagccggccgccgcggtgcaggtccgcagcccgtcgccggccgac
gacgccgcgcgcgaggagcgcgtgaagatgacgcggctgcgccagaccatcgcgcgcagg
ctcaaggaagttcagaacaccgcggcgatgctgacgaccttcaacgaggtcgacatgagc
cacatcatggcgctgcgcgcgcaatacaaggaggtgttcgagaagcgccaccactccaag
ctgggcttcatgggcttcttcgtccgcgcctgcgtgcaggcgctgaaggacattccggcg
gccaacgccgagatcgacggcaccgacctgatctacaagaactactaccacatcggcgtc
gcggtcggcaccgacaagggcctggtggtgccggtggtgcgcgactgcgaccacaagtcg
atcgcgcagatcgaaaagagcatcgccgatttcggcaagcgcgcccgcgacggccagctc
aagatcgacgagatgcagggcggcaccttcaccatcaccaatggcggcatctacggctcc
ttgatgtcgaccccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaagatc
caggaacgcccggtggcgatcgccggcaaggtcgagatccggccgatgatgtacttggcg
ctcagctacgaccaccgcgtgatcgacggcaaggacgccgtgaccttcctggtgcgggtc
aaggaaagcctggaggatccgacgcggctggtgctggatctgtaa

DBGET integrated database retrieval system