KEGG   Rhodopseudomonas palustris BisB18: RPC_0197Help
Entry
RPC_0197          CDS       T00336                                 

Definition
G-D-S-L lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rpc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(214887..215501)
Genome map
AA seq 204 aa AA seqDB search
MVGQSSAQTATAALTKPIKLVVLGDSLSAGYGLPAAAAFPARLQKALQDKGVATEMVNAG
VSGDTASGGLARLDWSIPKDTEAVIVELGANDALRGTDPKVTRDALDQIVKKLKARNIAV
FLCGMYAPPNYGPQYAAQFNAIYPELAKTYQVPLYPFFLEGVATIAKLNQADGLHPTAEG
IDTVVKNILPSVQAFLGTVAEQRS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggtcggacaaagcagcgcacagaccgcgacggcggcgctcaccaagccgatcaagctc
gtggtgctgggcgattccttgagcgccggctacggcctgccggccgccgcggcgtttccg
gcgcgcctgcaaaaggccttgcaggacaagggcgtggccaccgagatggtgaatgccggc
gtgtccggcgacaccgcctccggcgggcttgcgcggctcgactggtcgatcccgaaagac
accgaggcggtgatcgtcgaactcggcgccaacgacgccttgcgcggcaccgatcccaag
gtcacccgcgacgcgcttgaccagatcgtgaagaagctgaaggcgcgcaacatcgcggta
tttttgtgcgggatgtacgcgccgccgaactacggcccgcaatacgcggcgcaattcaac
gcgatctatccggagctggcgaagacctaccaggtgccgctgtatccgttctttctcgag
ggcgtcgccaccatcgccaaactgaaccaggccgacgggctgcaccccaccgcggaaggg
atcgacaccgtggttaagaatatcctgcccagcgtgcaggcatttctcggcaccgttgct
gagcaacgcagttga

DBGET integrated database retrieval system