KEGG   Rhodopseudomonas palustris BisB18: RPC_0344Help
Entry
RPC_0344          CDS       T00336                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00071  Fatty acid degradation
rpc00280  Valine, leucine and isoleucine degradation
rpc00281  Geraniol degradation
rpc00310  Lysine degradation
rpc00360  Phenylalanine metabolism
rpc00362  Benzoate degradation
rpc00380  Tryptophan metabolism
rpc00410  beta-Alanine metabolism
rpc00627  Aminobenzoate degradation
rpc00640  Propanoate metabolism
rpc00650  Butanoate metabolism
rpc00903  Limonene and pinene degradation
rpc00930  Caprolactam degradation
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPC_0344
   00650 Butanoate metabolism
    RPC_0344
  Lipid metabolism
   00071 Fatty acid degradation
    RPC_0344
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPC_0344
   00310 Lysine degradation
    RPC_0344
   00360 Phenylalanine metabolism
    RPC_0344
   00380 Tryptophan metabolism
    RPC_0344
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPC_0344
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPC_0344
   00281 Geraniol degradation
    RPC_0344
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_0344
   00627 Aminobenzoate degradation
    RPC_0344
   00930 Caprolactam degradation
    RPC_0344
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPC_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABD85919
UniProt: Q21CG7
Position
complement(365462..366265)
Genome map
AA seq 267 aa AA seqDB search
MSKNDTVLVERNGPVLIVSINRPQSRNAVDPATAQKLFDTFLAFDADDTASVAVLTGCGG
HFCAGADLKAVADGDLHNPGAIGGHGTLAPMGPSRLRLSKPVIAAVEGYAVAGGLELALW
ADMRVVADDATFGVFCRRFGVPLIDLGTIRLPRLIGQSHAMDLILTGRPMSGIEAHRVGL
ANRLVRRGEAATQAIAIAREIAHFPQACLRADRASALGQWDMPEEDAIAAELRGGLAVIA
SGETADGAARFAAGFGRHGVFGAEAGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacgacacggttctggtcgagcggaacggaccggtcctgatcgtctcgatc
aaccggccgcaaagccgcaacgcggtcgacccggcgaccgcgcagaaactgttcgacacg
ttcttggcgttcgacgccgacgacaccgcctcggtcgcggtgctgaccggctgcggcggc
catttctgcgccggcgccgacctcaaggcggtcgccgacggcgatttgcacaaccccggc
gcgatcggcggccacggcacgctggcgccgatgggcccgagccggttgcggctgagtaag
ccggtgatcgccgcggtcgagggctacgcggtggccggcgggctggagctcgcgttgtgg
gcggacatgcgggtggtggccgacgacgccaccttcggggtgttctgccgccgcttcggc
gtgccgctgatcgacctcggcaccatccggctgccgcggctgatcggacaatcgcacgcc
atggatctgattctcaccggccggccgatgtccggcatcgaggcgcatcgcgtcgggctc
gccaaccggctggtgcggcgcggcgaggccgccacccaggcgatcgccatcgccagggag
atcgcgcatttcccgcaggcctgcctgcgcgccgatcgcgcttcggcgctgggccaatgg
gacatgcccgaggaagacgccatcgcggccgagctgcgcggcggcctggcggtgatcgcc
tcgggcgaaaccgccgacggcgcagcgcggtttgccgcgggcttcggtcgccacggcgtg
ttcggcgccgaggccggcgaatga

DBGET integrated database retrieval system