KEGG   Rhodopseudomonas palustris BisB18: RPC_0381Help
Entry
RPC_0381          CDS       T00336                                 

Gene name
dut
Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RPC_0381 (dut)
Enzymes [BR:rpc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     RPC_0381 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408696..409154
Genome map
AA seq 152 aa AA seqDB search
MTVAISAAVQQLPHGQGLALPAYQSAHAAGLDLLAAVAPDAPLVLAPGTYALVPTGLTLA
LPPGYEAQVRPRSGLAARHGVTVLNAPGTIDADYRGEIGVLLINHGSQPFTVRRGERIAQ
MVVARVARVDLTVAASLETTERGSGGFGSTGR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgctatctccgccgccgtccagcaattgccgcatggccagggcctcgcgctg
ccggcctatcagagcgcgcatgccgcagggctcgacttgctcgccgcggtcgcccccgac
gcgccgctggtgctggcgcccggcacctacgcgctggtgccgaccggactgacgctggca
ttgccgcccggctacgaggcgcaggtgcggccgcgctccggactcgccgcgcgccacggc
gtcaccgtgctgaacgcgcccggcaccatcgacgccgactatcgcggcgagatcggcgtg
ctgttgatcaaccacggcagccagccgttcacggtccggcgcggcgagcgaatcgcccag
atggtggtcgcccgggtggcgcgggtcgacctcacggtcgccgcctcgctggaaaccacc
gagcgtggcagcggcggattcggctcgaccggccgctaa

DBGET integrated database retrieval system