KEGG   Rhodopseudomonas palustris BisB18: RPC_0392Help
Entry
RPC_0392          CDS       T00336                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPC_0392
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPC_0392
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPC_0392
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPC_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(425674..426888)
Genome map
AA seq 404 aa AA seqDB search
MTTQLPNSFRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYAGAKADPSFQREMDGYLK
DYVGRPSPLYFAERLTDHLGGAKIYFKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAE
TGAGQHGVATATLCARFGLECIVFMGAVDVERQQPNVIRMQMLGAKVVPVQSGARTLKDA
MNEALRDWVTNVSDTFYCIGTAAGPHPYPMMVRDFQSIIGTETKTQMQAAEGRLPDSLVA
CIGGGSNALGLFHPFLDDPTVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDD
DGQIQEGHSISAGLDYPGIGPEHSWLHETGRVTYLSATDDEALAAFQLLSRLEGIIPALE
PAHAIAKVLELAPQRPKDHLMVINLSGRGDKDIPQVAEILRGQK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcagctgccaaattcgtttcgctccggccccgacgagcgcgggcatttcggc
atcttcggcggacgcttcgtcgccgaaaccttgatgccgctgatcctcgatctggaaaaa
gcctatgccggcgccaaggccgacccttcgtttcagcgcgagatggacggctatctgaag
gattatgtcggccggccgtcgccgctgtatttcgccgagcgtctcaccgaccacctcggc
ggcgcgaaaatctactttaagcgcgaggagctcaaccacaccggctcgcacaaggtcaac
aacgtgctcggccagatcatggtggcgcggcggatgggcaagaagcgcatcatcgccgaa
accggcgccggccagcacggcgtcgccaccgcgacgctgtgcgcgcggttcgggctggaa
tgcatcgtcttcatgggtgcggtcgacgtcgagcggcagcagcccaatgtgatccggatg
cagatgctcggcgccaaggtggtcccggtgcagtccggcgcccgcacgctgaaggacgcg
atgaacgaggcgctgcgcgactgggtcaccaacgtcagcgacacgttctactgcatcggc
accgccgccgggccgcatccctatccgatgatggtgcgcgacttccagtcgatcatcggc
accgagaccaagacgcagatgcaggccgccgaaggccggctgccggattcgctggtcgcc
tgcatcggcggcggctccaatgcgctggggctgtttcatccgttcctggacgatcccacg
gtcgagatcttcggcgtcgaagccgcgggccatggtctcacgcaattgcacgccgcatcg
atcgccggcggccgccccggcgtgctgcacggcaaccgcacttatctcctgatggacgac
gacggccaaatccaggaaggccattcgatctccgccgggctcgattatcccggcatcggc
ccggagcattcctggctgcacgagaccggccgcgtcacttacctcagcgccaccgacgac
gaggcgctggcggcgttccaattgctgtcgcggctcgaaggcatcatcccggcgctggag
ccggcgcacgccatcgccaaggtgctcgaactcgcaccgcagcggccgaaggaccacctg
atggtgatcaacctctccggccgcggcgacaaggacatcccgcaagtggctgagattttg
cgggggcagaagtga

DBGET integrated database retrieval system