KEGG   Rhodopseudomonas palustris BisB18: RPC_0428Help
Entry
RPC_0428          CDS       T00336                                 

Definition
(GenBank) Twin-arginine translocation pathway signal
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00910  Nitrogen metabolism
rpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RPC_0428
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RPC_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 Copper-bind TAT_signal
Motif
Other DBs
NCBI-ProteinID: ABD86003
UniProt: Q21C83
Position
461281..463230
Genome map
AA seq 649 aa AA seqDB search
MTDNTKDSKGVSRRTLLGTTAAAAGVGLAGGIALTGDGTGLIATADAQTKAAPTLPARPA
IQKAEVAPGELDEYYTFFSSGQTGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKI
LTEGLLPESREFLKTRGGTYMNGDLHHPHLSFTEGTYDGRYAFMNDKANTRVARVRLDVM
KCDKIIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDGSNLDKSKDYHAIFTAIDG
DTMKVAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVNAAEMTANEQDWVVIFNIKRIE
EAVKKGDFKEMGGVPVIDGRHGSRYTRYVPVSNSPHGMNTAPDGIHIVANGKLSPTVTVM
DVRKFDDLFDDKIKPRDVVVAEPQLGLGPLHTAYDGRGNAYTTLFLDSQICKWNIDLAKR
AFKGEKVDPIIDKIDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPEND
QLIDISGEKMKLIHDGPSFAEPHDATIVHRSKINPISIWNRADPMFEDAVKQAKLDGVKL
ESDSKVIRDGDKVRVYMTSQAPAFGLEKFQVKQGDKVTVYVTNIDDVEDLTHGFSIVNYG
IQMEVAPQATASVTFSADRAGVYWYYCSWFCHAMHMEMKGRMLVEPKTV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaacacgaaggacagtaagggtgtcagccggcgtacgctgctcggaaccacg
gccgcggcggccggtgtcggcctcgcgggcgggatcgcgctgaccggcgacggcaccggg
ctgatcgccacggccgacgcccagaccaaagccgcgccgacgctgccggcgcgtccggcg
atccagaaggccgaggtggccccgggcgaactcgacgaatactacacgttcttctccagc
ggccagaccggcgaattgcggatcgtcggcctgccgtcgatgcgcgaactgatgcgggtg
ccggtgttcaaccgctgcagcgccaccggctggggccagaccaatgaaagcctgaagatt
ctgaccgaagggctgctgccggaaagccgcgaattcctgaagacccgcggcggcacctat
atgaacggcgatctgcatcacccgcatctgtcgttcaccgagggcacctatgacggccgc
tacgccttcatgaacgacaaggccaacacccgcgtcgcacgcgtccggctcgacgtgatg
aaatgcgacaagatcatccagctgccgaaccagcacaccgtgcacggcttgcgggtgcag
aaatatccgcgcaccggctacgtgttctgcaacggcgaagaccgcgtgccgctgcccaac
gacggcagcaatctcgacaagtccaaggattatcacgcgatcttcaccgcgatcgacggc
gacaccatgaaggtggcctggcaggtgatggtcgacggcaatctcgacaatgtcgacgcc
gactaccagggcaaatatgccttcgcgacctgctacaactccgaagaaggcgtcaacgcc
gcggagatgaccgccaacgagcaggactgggtggtgatcttcaacatcaagcgcatcgaa
gaggcggtgaagaagggcgacttcaaggaaatgggcggcgtgccggtgatcgacggccgc
cacggctcgcgctacacccgctacgtgccggtctccaacagcccgcacggcatgaacacc
gcgccggacggcatccacatcgtcgccaacggcaagctgtcgccgaccgtcacggtgatg
gacgtgcgcaaattcgacgacctgttcgacgacaagatcaagccgcgcgacgtcgtggtc
gccgaaccgcagctcgggctcggcccgttgcacaccgcctatgacggccgcggcaacgcc
tacaccacgctgttcctcgacagccagatctgcaaatggaacatcgatctcgccaagcgc
gccttcaagggcgagaaggtcgacccgatcatcgacaagatcgacgtgcactatcagccc
ggccacaatcattcctcgatgggtcagaccaaagaggccgacggaaaatggctgatctcg
ctgaacaagttctccaaggaccgcttcctcaacgtcggcccgctgaagccggagaacgat
cagctgatcgacatctccggcgagaagatgaagctgatccacgacggcccgagcttcgcc
gagccgcatgacgccaccatcgttcaccgctccaagatcaacccgatctcgatctggaac
cgggccgatccgatgttcgaggacgcggtgaagcaggccaagctcgacggcgtcaaactg
gagagcgactccaaggtgatccgcgacggcgacaaggtgcgggtctacatgacctcgcag
gcgccggcgttcgggctggagaagttccaggtcaagcagggcgacaaggtgaccgtctac
gtcaccaacatcgacgacgtcgaggatctcacccacggcttctcgatcgtcaactacggc
atccagatggaagtggccccgcaggccaccgcctcggtgacgttctcggccgatcgcgcc
ggggtgtattggtactactgctcgtggttctgccacgccatgcacatggagatgaaaggc
cgcatgctggtcgaaccgaagacggtgtga

DBGET integrated database retrieval system