KEGG   Rhodopseudomonas palustris BisB18: RPC_0428Help
Entry
RPC_0428          CDS       T00336                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rpc00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461281..463230
Genome map
AA seq 649 aa AA seqDB search
MTDNTKDSKGVSRRTLLGTTAAAAGVGLAGGIALTGDGTGLIATADAQTKAAPTLPARPA
IQKAEVAPGELDEYYTFFSSGQTGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKI
LTEGLLPESREFLKTRGGTYMNGDLHHPHLSFTEGTYDGRYAFMNDKANTRVARVRLDVM
KCDKIIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDGSNLDKSKDYHAIFTAIDG
DTMKVAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVNAAEMTANEQDWVVIFNIKRIE
EAVKKGDFKEMGGVPVIDGRHGSRYTRYVPVSNSPHGMNTAPDGIHIVANGKLSPTVTVM
DVRKFDDLFDDKIKPRDVVVAEPQLGLGPLHTAYDGRGNAYTTLFLDSQICKWNIDLAKR
AFKGEKVDPIIDKIDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPEND
QLIDISGEKMKLIHDGPSFAEPHDATIVHRSKINPISIWNRADPMFEDAVKQAKLDGVKL
ESDSKVIRDGDKVRVYMTSQAPAFGLEKFQVKQGDKVTVYVTNIDDVEDLTHGFSIVNYG
IQMEVAPQATASVTFSADRAGVYWYYCSWFCHAMHMEMKGRMLVEPKTV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaacacgaaggacagtaagggtgtcagccggcgtacgctgctcggaaccacg
gccgcggcggccggtgtcggcctcgcgggcgggatcgcgctgaccggcgacggcaccggg
ctgatcgccacggccgacgcccagaccaaagccgcgccgacgctgccggcgcgtccggcg
atccagaaggccgaggtggccccgggcgaactcgacgaatactacacgttcttctccagc
ggccagaccggcgaattgcggatcgtcggcctgccgtcgatgcgcgaactgatgcgggtg
ccggtgttcaaccgctgcagcgccaccggctggggccagaccaatgaaagcctgaagatt
ctgaccgaagggctgctgccggaaagccgcgaattcctgaagacccgcggcggcacctat
atgaacggcgatctgcatcacccgcatctgtcgttcaccgagggcacctatgacggccgc
tacgccttcatgaacgacaaggccaacacccgcgtcgcacgcgtccggctcgacgtgatg
aaatgcgacaagatcatccagctgccgaaccagcacaccgtgcacggcttgcgggtgcag
aaatatccgcgcaccggctacgtgttctgcaacggcgaagaccgcgtgccgctgcccaac
gacggcagcaatctcgacaagtccaaggattatcacgcgatcttcaccgcgatcgacggc
gacaccatgaaggtggcctggcaggtgatggtcgacggcaatctcgacaatgtcgacgcc
gactaccagggcaaatatgccttcgcgacctgctacaactccgaagaaggcgtcaacgcc
gcggagatgaccgccaacgagcaggactgggtggtgatcttcaacatcaagcgcatcgaa
gaggcggtgaagaagggcgacttcaaggaaatgggcggcgtgccggtgatcgacggccgc
cacggctcgcgctacacccgctacgtgccggtctccaacagcccgcacggcatgaacacc
gcgccggacggcatccacatcgtcgccaacggcaagctgtcgccgaccgtcacggtgatg
gacgtgcgcaaattcgacgacctgttcgacgacaagatcaagccgcgcgacgtcgtggtc
gccgaaccgcagctcgggctcggcccgttgcacaccgcctatgacggccgcggcaacgcc
tacaccacgctgttcctcgacagccagatctgcaaatggaacatcgatctcgccaagcgc
gccttcaagggcgagaaggtcgacccgatcatcgacaagatcgacgtgcactatcagccc
ggccacaatcattcctcgatgggtcagaccaaagaggccgacggaaaatggctgatctcg
ctgaacaagttctccaaggaccgcttcctcaacgtcggcccgctgaagccggagaacgat
cagctgatcgacatctccggcgagaagatgaagctgatccacgacggcccgagcttcgcc
gagccgcatgacgccaccatcgttcaccgctccaagatcaacccgatctcgatctggaac
cgggccgatccgatgttcgaggacgcggtgaagcaggccaagctcgacggcgtcaaactg
gagagcgactccaaggtgatccgcgacggcgacaaggtgcgggtctacatgacctcgcag
gcgccggcgttcgggctggagaagttccaggtcaagcagggcgacaaggtgaccgtctac
gtcaccaacatcgacgacgtcgaggatctcacccacggcttctcgatcgtcaactacggc
atccagatggaagtggccccgcaggccaccgcctcggtgacgttctcggccgatcgcgcc
ggggtgtattggtactactgctcgtggttctgccacgccatgcacatggagatgaaaggc
cgcatgctggtcgaaccgaagacggtgtga

DBGET integrated database retrieval system