KEGG   Rhodopseudomonas palustris BisB18: RPC_0668Help
Entry
RPC_0668          CDS       T00336                                 

Definition
twin-arginine translocation pathway signal (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rpc  Rhodopseudomonas palustris BisB18
Brite
Enzymes [BR:rpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     RPC_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728539..729645
Genome map
AA seq 368 aa AA seqDB search
MTAPRHIPTSSKRGVTRRQLLRTAPAAALLALASPGARAAAIRPRRKIPYGAAVALDDLR
GDPRLGAALAGTCSQIVPVSELKWSELRPAPGQFAFEKADALAGFAADNGLAMRGHTLVW
YAALPDWTKEIDSEAAAERALREHIETVVSRYRGRIRSWDVVNEVIPDEAHQPTDRRPSL
WSRYLGERYIPLAFRIAAEADPKAQLVLNDYDIEFGDPRCRRKRAAFRHLIRQLQDADVP
IHAVGLQCHLHGEMAVDRAGLESFVAELHGNGLKCLVTELDVMDQHLPAPVQRRDALVAA
QVGELLAAVTAPGPLDALLTWGISDRYSWIPYAAPRADKRPNRPLPLDREFQRKPFMDVI
DQFTGREA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgccacggcacatcccgacctcctcgaagcgcggtgtaacacgccggcaattg
ctgcggaccgcgccggccgcagcgctgcttgcgctggcgtcgcccggcgcgcgcgcggcc
gccatccgcccgcgtcgcaagatcccctatggcgcagcggtcgcgctcgacgatctgcgc
ggcgatccgcggctcggcgccgcgctcgccggcacttgcagccagatcgtgccggtgagc
gaattgaaatggagcgagctgcggccggcgccggggcaatttgccttcgagaaggccgat
gcgctcgccggcttcgcggccgacaacggccttgcgatgcgcggccatacgctggtctgg
tacgccgccttgccggactggacgaaggagatcgacagcgaagccgccgccgaacgcgcg
ctgcgcgagcacatcgagaccgtggtgtcgcgctatcgcggccggatccgctcctgggac
gtggtgaacgaggtgatccccgacgaggcccatcagcccaccgaccgccggccatcgctg
tggtcgcgctatctcggcgagcgctacatcccgttggcgttccggatcgccgcggaagcg
gatcccaaggcgcagctggtgctcaacgactacgacatcgaattcggcgacccgcgctgc
cgccgcaagcgcgcggcgtttcgtcatttgatccggcagttgcaggacgccgatgtgccg
atccatgcggtcgggctgcaatgtcatctgcacggcgagatggcggtcgatcgcgccggg
ctcgagagcttcgtggccgagttgcacggcaacggtctcaaatgcctggtgaccgaactc
gacgtgatggatcagcatttgccggcgccggtgcaacgccgcgacgcgctggtcgccgcg
caggtcggcgagctgctcgccgcggtgaccgcgccggggccgctcgacgctttgctgacc
tggggcatttccgaccgttacagctggattccctatgcggcgccgcgcgccgataagcgg
cccaaccggccgctgccgctcgatcgcgaattccagcgcaagccgttcatggacgtcatc
gatcaattcaccggcagggaggcatga

DBGET integrated database retrieval system