KEGG   Rhodopseudomonas palustris BisB18: RPC_0699Help
Entry
RPC_0699          CDS       T00336                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPC_0699
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPC_0699
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPC_0699
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPC_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(762023..763387)
Genome map
AA seq 454 aa AA seqDB search
MSDQVKYVLDEDQIPKAWYNLNADFPKPMPAVLHPGTHQPIGPSDLEPLFPMNLILQEVS
TERYIEIPDPVRDVFRMWRPSPLIRARRLERLLDTPAKIYFKYEGVSPAGSHKPNTAVPQ
AWYNKEAGIKRLSTETGAGQWGSSLAFAGSLFGIDVTVFQVRVSYDQKPYRRALMETYGA
RCVASPSNETEAGRAVLAKDPNSPGSLGMAISEAVEIAAKDPGVKYALGSVLNHVMLHQT
IIGEETIRQFELANDDPDVVIGCAGGGSNFAGLCFPYLGLQLRGGRSRRFIAVEPAACPT
LTRGKYAYDFGDTAHLTPLMKMHTLGSTFMPPGFHAGGLRYHGMSAMVSHAYELGLIEAR
SYQQRGCFEAGVQFARAEGIVPAPESTHAVRCAIDEALRCKAEGKAETIVFNLSGHGHFD
MQAYINFFEGKLVDLDYDEAALAQSLADLPNIAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccaggtcaaatacgtgctcgacgaagatcagattccaaaggcttggtacaat
ctgaacgcagattttcccaagccgatgccggcggtgctgcatcccggcacgcatcagccg
atcggcccgtcggatctcgagccgctgtttccgatgaatctgatccttcaggaagtttcg
accgaacgctacatcgaaattcccgatccggtgcgcgacgtgttccggatgtggcggccg
tcgccgctgatccgcgcccggcggctggagaggctgctcgataccccggccaagatctat
ttcaaatatgaaggcgtctcgccggccggctcgcacaagccgaacaccgcggtgccgcag
gcctggtacaacaaggaagccggcatcaagcggctgtcgaccgaaaccggcgccggccaa
tggggctcgtcgctggcgttcgccggctcgctgttcggcatcgacgtcacggtgtttcag
gtccgggtgtcgtacgaccagaagccgtatcgccgcgcgctgatggaaacctacggcgcg
cgctgcgtggcgtcgccgtcgaacgagaccgaagccggccgcgccgtgctggccaaggat
cccaacagcccgggctcgctcggcatggcgatttccgaggcggtcgagatcgccgccaag
gacccgggcgtgaaatatgcgctgggctcggtgctcaaccatgtgatgctgcaccagacc
atcatcggcgaagagaccatccggcagttcgaactcgccaacgacgatcccgacgtggtg
atcggctgcgccggcggcggctccaacttcgccgggttgtgcttcccctatctcgggctg
cagctgcgcggcggccgctcgcgccgcttcatcgcggtggagcccgccgcctgcccgacg
ctgacccgcggcaaatacgcctatgatttcggcgacaccgcgcatctgacgccgctgatg
aagatgcacacgctgggctcgaccttcatgccgcccggcttccacgccggcgggctgcgc
tatcacggcatgagcgcgatggtgtcgcacgcctatgagctcgggctgatcgaggcgcgc
tcctatcagcagcgcggctgcttcgaggccggggtgcagttcgcccgcgccgaaggcatc
gtgccggcgccggaatccacccacgcggtgcgctgcgcgatcgacgaggcgttgcgctgc
aaggccgagggcaaggcggagaccatcgtcttcaacctgtccggccacggccatttcgac
atgcaggcctatatcaatttcttcgaaggcaagctggtcgacctcgactacgacgaggcg
gcgctggcgcagtcgctggccgacctgccgaacatcgcggcgtaa

DBGET integrated database retrieval system