KEGG   Rhodopseudomonas palustris BisB18: RPC_0700Help
Entry
RPC_0700          CDS       T00336                                 

Definition
PfkB
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rpc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rpc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rpc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(763602..764570)
Genome map
AA seq 322 aa AA seqDB search
MSQIVTVTPSPAIDASTSVGKIAAFSKLRCAPLRRHPGGGGINVARVIQRLGGEVRAVYP
SGGATGELLRELLDREGINGITVAVAAETREDFTVFEESTRQQFRFMMPGSPLADPEWAQ
LIQAALVGPPAFIIASGSVPPGAPEDFFGRIVQAGSALGAKVVVDTSRQPLQAALQSGLF
LIKPSLSEFWNLTGLNCDDDATLIDAARDLIDRGLVEMVALSMGPNGALLVSRDRALRAE
GLAVEAATVSGAGDSFLAAMVWSLQNDPDLATALRFGIAAGTAALVNPGTELAQPQDIAN
FLPQVRIREIAEAARVATSPLI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccagatcgtcaccgtcacgcccagccccgccatcgatgcctcgacctcggtcggt
aagattgctgctttctccaagctacgttgcgcgccgctgcggcgccaccccggcggcggc
ggtatcaacgtcgcgcgggtcatccagcggctcggcggcgaggtccgcgcggtctatccc
agcggcggcgccaccggcgaattgttgcgcgagctgctcgaccgcgaaggcatcaacggc
atcaccgtggcggtggcggcggagacccgcgaagatttcacggtgttcgaggagagcacg
cggcagcaattccgcttcatgatgccgggatcgccgctcgccgatccggagtgggcgcaa
ctgattcaagccgcactggtggggccgcccgccttcatcatcgccagcggcagcgtgccg
cccggcgcgccggaggatttcttcggccgcatcgtgcaggccggcagcgcgctcggcgcc
aaggtcgtggtcgacacctcgcgacagccgctgcaggccgcgctgcagagcggcctgttc
ttgatcaagccgagcctcagcgaattctggaatctgaccggcttgaactgcgacgacgac
gccacgctgatcgacgccgcgcgcgacttgatcgatcgcggcctggtggagatggtggcg
ctcagcatgggaccgaacggcgcgctgctggtcagccgcgaccgcgcgctgcgcgccgaa
ggccttgcggtcgaggccgccaccgtgtccggcgccggcgacagcttcctggcggcaatg
gtgtggagcctgcaaaacgatcccgatcttgccaccgcgctgcgcttcggcatcgcggcg
ggcacggccgcgttggtcaatcccggcaccgaactggcgcagccgcaggatattgcgaac
ttcctgccgcaggtccgcatccgcgagatcgccgaagccgcgcgcgtcgccacatcgccg
ctgatttga

DBGET integrated database retrieval system