KEGG   Rhodopseudomonas palustris BisB18: RPC_0700Help
Entry
RPC_0700          CDS       T00336                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00010  Glycolysis / Gluconeogenesis
rpc00030  Pentose phosphate pathway
rpc00051  Fructose and mannose metabolism
rpc00052  Galactose metabolism
rpc00680  Methane metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
rpc01230  Biosynthesis of amino acids
Module
rpc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPC_0700
   00030 Pentose phosphate pathway
    RPC_0700
   00051 Fructose and mannose metabolism
    RPC_0700
   00052 Galactose metabolism
    RPC_0700
  Energy metabolism
   00680 Methane metabolism
    RPC_0700
Enzymes [BR:rpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPC_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF1985
Motif
Other DBs
NCBI-ProteinID: ABD86272
UniProt: Q21BG4
Position
complement(763602..764570)
Genome map
AA seq 322 aa AA seqDB search
MSQIVTVTPSPAIDASTSVGKIAAFSKLRCAPLRRHPGGGGINVARVIQRLGGEVRAVYP
SGGATGELLRELLDREGINGITVAVAAETREDFTVFEESTRQQFRFMMPGSPLADPEWAQ
LIQAALVGPPAFIIASGSVPPGAPEDFFGRIVQAGSALGAKVVVDTSRQPLQAALQSGLF
LIKPSLSEFWNLTGLNCDDDATLIDAARDLIDRGLVEMVALSMGPNGALLVSRDRALRAE
GLAVEAATVSGAGDSFLAAMVWSLQNDPDLATALRFGIAAGTAALVNPGTELAQPQDIAN
FLPQVRIREIAEAARVATSPLI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccagatcgtcaccgtcacgcccagccccgccatcgatgcctcgacctcggtcggt
aagattgctgctttctccaagctacgttgcgcgccgctgcggcgccaccccggcggcggc
ggtatcaacgtcgcgcgggtcatccagcggctcggcggcgaggtccgcgcggtctatccc
agcggcggcgccaccggcgaattgttgcgcgagctgctcgaccgcgaaggcatcaacggc
atcaccgtggcggtggcggcggagacccgcgaagatttcacggtgttcgaggagagcacg
cggcagcaattccgcttcatgatgccgggatcgccgctcgccgatccggagtgggcgcaa
ctgattcaagccgcactggtggggccgcccgccttcatcatcgccagcggcagcgtgccg
cccggcgcgccggaggatttcttcggccgcatcgtgcaggccggcagcgcgctcggcgcc
aaggtcgtggtcgacacctcgcgacagccgctgcaggccgcgctgcagagcggcctgttc
ttgatcaagccgagcctcagcgaattctggaatctgaccggcttgaactgcgacgacgac
gccacgctgatcgacgccgcgcgcgacttgatcgatcgcggcctggtggagatggtggcg
ctcagcatgggaccgaacggcgcgctgctggtcagccgcgaccgcgcgctgcgcgccgaa
ggccttgcggtcgaggccgccaccgtgtccggcgccggcgacagcttcctggcggcaatg
gtgtggagcctgcaaaacgatcccgatcttgccaccgcgctgcgcttcggcatcgcggcg
ggcacggccgcgttggtcaatcccggcaccgaactggcgcagccgcaggatattgcgaac
ttcctgccgcaggtccgcatccgcgagatcgccgaagccgcgcgcgtcgccacatcgccg
ctgatttga

DBGET integrated database retrieval system